(data stored in ACNUC7421 zone)

EMBL: CP000675.PE593

CP000675.PE593       Location/Qualifiers
FT   CDS             620993..623518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="LPC_2809"
FT                   /product="Conjugal transfer protein trbE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2809"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56710"
FT                   /protein_id="ABQ56710.1"
FT                   /translation="MIELIAFLISTTGLVILGTLFWEIRSKSCGHHVKKHRSHTAGLVD
FT                   LLNYAAVVDDGVIVGKNGSFMAAWLYHGEDNANTTDEAREMVSFRINQALSAMGSGWMI
FT                   HVDAMRRTAPGYSARGYSHFPDPISMAVDEERRQLFEQLGTLYEGYFVITLTWYPPVLV
FT                   QKRFVELMFDDSGERLSQKAKTHQLIETFKQSCRNFESRMSSAVHLERLGSDDKGDTVM
FT                   QDNFLRHLQYCVTGINHPVNLPKNPIYLDALIGGQELTPGITPKIGRKFVQCVAIEGFP
FT                   MESYPGILTALSQLPIEYRWNSRFIFMDAHEAVAHFTKFRKKWKQKVRGFFDQIFNTNS
FT                   GIVDEDALSMVNDAQSAIAETNSGMVGQGYYTSVVVLMDEDRAQVEKAALFIEKNINAL
FT                   GFAARVETINTMDAFMGSLPGHGVENIRRPLINTMNLADLLPTSSIWTGENKAPCPLFP
FT                   PLSPPLMHCVTSGNAPFRLNLHVRDLGHGIMFGPTRSGKSTHLGLLALSWRRYKDARIY
FT                   SFDKGLSMYPTCKATGGEHYTIADKDSKLAFAPLQFLESKADRAWAMEWIDTILALNGL
FT                   DTTPAQRNEIGYAIISMHQSGSKTLSEFVMTIQDEHIRETLKQYTIDGLMGHLLDAECD
FT                   GLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLAHPVF
FT                   KNKIAEWLDSMAKKNCAVFMATQHLSHAAKSGILDIIVESTATKIFLPNLYARDPETCV
FT                   IYERMGLNPRQIDIIAQAQPKRDYYYVSEKGQRLYQLALGSMALAFVGATDPDSIARMK
FT                   QLELKYSDGWVSQWLTEKGIQLEQYGEAA"
     MIELIAFLIS TTGLVILGTL FWEIRSKSCG HHVKKHRSHT AGLVDLLNYA AVVDDGVIVG        60
     KNGSFMAAWL YHGEDNANTT DEAREMVSFR INQALSAMGS GWMIHVDAMR RTAPGYSARG       120
     YSHFPDPISM AVDEERRQLF EQLGTLYEGY FVITLTWYPP VLVQKRFVEL MFDDSGERLS       180
     QKAKTHQLIE TFKQSCRNFE SRMSSAVHLE RLGSDDKGDT VMQDNFLRHL QYCVTGINHP       240
     VNLPKNPIYL DALIGGQELT PGITPKIGRK FVQCVAIEGF PMESYPGILT ALSQLPIEYR       300
     WNSRFIFMDA HEAVAHFTKF RKKWKQKVRG FFDQIFNTNS GIVDEDALSM VNDAQSAIAE       360
     TNSGMVGQGY YTSVVVLMDE DRAQVEKAAL FIEKNINALG FAARVETINT MDAFMGSLPG       420
     HGVENIRRPL INTMNLADLL PTSSIWTGEN KAPCPLFPPL SPPLMHCVTS GNAPFRLNLH       480
     VRDLGHGIMF GPTRSGKSTH LGLLALSWRR YKDARIYSFD KGLSMYPTCK ATGGEHYTIA       540
     DKDSKLAFAP LQFLESKADR AWAMEWIDTI LALNGLDTTP AQRNEIGYAI ISMHQSGSKT       600
     LSEFVMTIQD EHIRETLKQY TIDGLMGHLL DAECDGLGLS SFMTFEIEHL MGLGEKFALP       660
     VLLYLFRRIE TSLDGRPTLI LLDEAWLMLA HPVFKNKIAE WLDSMAKKNC AVFMATQHLS       720
     HAAKSGILDI IVESTATKIF LPNLYARDPE TCVIYERMGL NPRQIDIIAQ AQPKRDYYYV       780
     SEKGQRLYQL ALGSMALAFV GATDPDSIAR MKQLELKYSD GWVSQWLTEK GIQLEQYGEA       840
     A                                                                       841
//

If you have problems or comments...

PBIL Back to PBIL home page