(data stored in ACNUC7421 zone)

EMBL: CP000675.PE594

CP000675.PE594       Location/Qualifiers
FT   CDS             623515..624258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="LPC_2808"
FT                   /product="Conjugal transfer protein trbF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2808"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56709"
FT                   /protein_id="ABQ56709.1"
FT                   /translation="MKKIKQWLNTKRPEKKNEALTENPFLNARRAWNVHTAGLMKSVQV
FT                   WQLVGLSSLLLALAAVGGLISIGSQSKFIPLVFQQDANGNTLSVTRADRVGQANIDDYR
FT                   AAAAHFIENIRMVSSDVELQKKAVFQVYSYLNQNDAALAKVQEFYSNKQQSNPFERATH
FT                   EIVSIEIRSVLQESDETWQVDWVETVRNRDGTLKEKPYVMKAMITMYQDNELNDVSSES
FT                   ILKNPHLIFIRDFNWSYELKHGEQR"
     MKKIKQWLNT KRPEKKNEAL TENPFLNARR AWNVHTAGLM KSVQVWQLVG LSSLLLALAA        60
     VGGLISIGSQ SKFIPLVFQQ DANGNTLSVT RADRVGQANI DDYRAAAAHF IENIRMVSSD       120
     VELQKKAVFQ VYSYLNQNDA ALAKVQEFYS NKQQSNPFER ATHEIVSIEI RSVLQESDET       180
     WQVDWVETVR NRDGTLKEKP YVMKAMITMY QDNELNDVSS ESILKNPHLI FIRDFNWSYE       240
     LKHGEQR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page