(data stored in ACNUC7421 zone)

EMBL: CP000675.PE595

CP000675.PE595       Location/Qualifiers
FT   CDS             624255..625130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="LPC_2807"
FT                   /product="Conjugal transfer protein trbG precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2807"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56708"
FT                   /protein_id="ABQ56708.1"
FT                   /translation="MKKIMLTFCLLMPLTGFALDNNELATRYFSENDPKLSNQEKQALD
FT                   IAERWQKGDKTSKPFPSSDGSVSFVYGSGQIRVVCAPLQVCDIALQAGEQFNDMNVGDP
FT                   RFIVEPSITGSGAAQQIHLLIKPKDVGLDSSLVVTTDRRTYHFRLKSDRTEFMPYVSFI
FT                   YPDEAKAKWQFIQNVQAERRKMDTLPETNEYLGNLNFNYRIQGHARFKPLRVYNNGVKT
FT                   IIEMPKTMAQSEAPVLLVLRSRGLFQKSESVMVNYRLQGCRYIVDSVFDRAILVIGSGS
FT                   SQEKITITRC"
     MKKIMLTFCL LMPLTGFALD NNELATRYFS ENDPKLSNQE KQALDIAERW QKGDKTSKPF        60
     PSSDGSVSFV YGSGQIRVVC APLQVCDIAL QAGEQFNDMN VGDPRFIVEP SITGSGAAQQ       120
     IHLLIKPKDV GLDSSLVVTT DRRTYHFRLK SDRTEFMPYV SFIYPDEAKA KWQFIQNVQA       180
     ERRKMDTLPE TNEYLGNLNF NYRIQGHARF KPLRVYNNGV KTIIEMPKTM AQSEAPVLLV       240
     LRSRGLFQKS ESVMVNYRLQ GCRYIVDSVF DRAILVIGSG SSQEKITITR C                291
//

If you have problems or comments...

PBIL Back to PBIL home page