(data stored in ACNUC7421 zone)

EMBL: CP000675.PE599

CP000675.PE599       Location/Qualifiers
FT   CDS             627582..627794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2803"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2803"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56704"
FT                   /protein_id="ABQ56704.1"
FT                   /translation="MKRLSLSIMVFACLLSGCESTETKARKKSEHLASLTCDSPREGHT
FT                   KEELQAIVEACFRGGSYSKSSGKKW"
     MKRLSLSIMV FACLLSGCES TETKARKKSE HLASLTCDSP REGHTKEELQ AIVEACFRGG        60
     SYSKSSGKKW                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page