(data stored in ACNUC7421 zone)

EMBL: CP000675.PE60

CP000675.PE60        Location/Qualifiers
FT   CDS             complement(60219..60923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54060"
FT                   /protein_id="ABQ54060.1"
FT                   /translation="MIREYMDKRNNQFTTEILNYFSDLKKFSTSYLGWLTMEHYQFSLN
FT                   NTRFLMNSHIQTKSLSDPGVSEELLANYNEEKNHAQMYRHALKKIGLDVTNRIPYVATR
FT                   QFFMRLEALIEVNASKTLGVMYATETAAIFEHILFKEISAELCQRKRLDFENSRIKQFH
FT                   DLHLDGVEQAHKDELGKFMDHTLAQEHVDPNIFLQEKEIIDGAYAAIDIMEDWWSGLIN
FT                   AKAHLLEQAHAQ"
     MIREYMDKRN NQFTTEILNY FSDLKKFSTS YLGWLTMEHY QFSLNNTRFL MNSHIQTKSL        60
     SDPGVSEELL ANYNEEKNHA QMYRHALKKI GLDVTNRIPY VATRQFFMRL EALIEVNASK       120
     TLGVMYATET AAIFEHILFK EISAELCQRK RLDFENSRIK QFHDLHLDGV EQAHKDELGK       180
     FMDHTLAQEH VDPNIFLQEK EIIDGAYAAI DIMEDWWSGL INAKAHLLEQ AHAQ             234
//

If you have problems or comments...

PBIL Back to PBIL home page