(data stored in ACNUC7421 zone)

EMBL: CP000675.PE601

CP000675.PE601       Location/Qualifiers
FT   CDS             629193..631082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="LPC_2801"
FT                   /product="Conjugal transfer protein traG"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2801"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56702"
FT                   /protein_id="ABQ56702.1"
FT                   /translation="MSLNKPNKAIGPQVRQKHNEKTNKQLVILVALSLFISMQVGTQFV
FT                   AYKLHFSDELGFSLNHVYFPWQSLWWSLKYHHYYPDYFNAAFGLMAMSGSLFLMLIVFV
FT                   AKHLKKENISEYLHGSARWANRDDLKNAGLFGNEEGVYVGAIEDEKGDIHYLRHNGPEH
FT                   ILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKHANNKVIRFEPAT
FT                   LKGSARWNPLDEIRAGTEYEVGDVQNLATLVIDPDGKGLETHWQKTSQALLVGFILHAI
FT                   YKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHVDGKTHFVISASARDMIDRPE
FT                   EEAGSVLSTLKSYLALYRDPIVAYNVSASDFCIKDLMHHASPVSLYIVTQPNDKARLQP
FT                   LVRVMLNMVVRLLADKMEFERVDDGRGNYFVRTKKTYKHRLLCMIDEFPSLGKLDILQE
FT                   SLAFVAGYGLKFYLICQDINQLKSRERGYGPDETITSNCHIQNAYPPNRIETAEHLSKL
FT                   TGQTTIVKEHTTTSGKRFSTFLNQISKTKQEVSRPLLTVDECQRMPGPKKDENGLIKEA
FT                   GDMVVYVAGFPAIYGKQPLYFKDPVFIARASVEAPEQSDILRARLREDEEIRL"
     MSLNKPNKAI GPQVRQKHNE KTNKQLVILV ALSLFISMQV GTQFVAYKLH FSDELGFSLN        60
     HVYFPWQSLW WSLKYHHYYP DYFNAAFGLM AMSGSLFLML IVFVAKHLKK ENISEYLHGS       120
     ARWANRDDLK NAGLFGNEEG VYVGAIEDEK GDIHYLRHNG PEHILTYAPT RSGKGVGLVI       180
     PTLLSWKQSC VITDLKGELW ALTAGWRQKH ANNKVIRFEP ATLKGSARWN PLDEIRAGTE       240
     YEVGDVQNLA TLVIDPDGKG LETHWQKTSQ ALLVGFILHA IYKLKNQGEP ATFPNIDRML       300
     VDPNTNIADL LIEMTQYPHV DGKTHFVISA SARDMIDRPE EEAGSVLSTL KSYLALYRDP       360
     IVAYNVSASD FCIKDLMHHA SPVSLYIVTQ PNDKARLQPL VRVMLNMVVR LLADKMEFER       420
     VDDGRGNYFV RTKKTYKHRL LCMIDEFPSL GKLDILQESL AFVAGYGLKF YLICQDINQL       480
     KSRERGYGPD ETITSNCHIQ NAYPPNRIET AEHLSKLTGQ TTIVKEHTTT SGKRFSTFLN       540
     QISKTKQEVS RPLLTVDECQ RMPGPKKDEN GLIKEAGDMV VYVAGFPAIY GKQPLYFKDP       600
     VFIARASVEA PEQSDILRAR LREDEEIRL                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page