(data stored in ACNUC7421 zone)

EMBL: CP000675.PE602

CP000675.PE602       Location/Qualifiers
FT   CDS             631079..631624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="LPC_2800"
FT                   /product="Plasmid transfer protein traF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2800"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56701"
FT                   /protein_id="ABQ56701.1"
FT                   /translation="MKKFTSWIAVLMLSIIGMAFLFMLMGFRVNTTDSIPFGLYRITNI
FT                   KNIKNAYVIFCPDDRPVFKQGLDRGYIGSGLCPGGYGYLMKKVVATNGDQISITSDGVF
FT                   VNRQLILFSKPTLIDGRKRPLPQWRTIDYQIKEDELITMTSQSECSFDSRYYGPIRIGQ
FT                   IKGVIKPIWVNATSGEIA"
     MKKFTSWIAV LMLSIIGMAF LFMLMGFRVN TTDSIPFGLY RITNIKNIKN AYVIFCPDDR        60
     PVFKQGLDRG YIGSGLCPGG YGYLMKKVVA TNGDQISITS DGVFVNRQLI LFSKPTLIDG       120
     RKRPLPQWRT IDYQIKEDEL ITMTSQSECS FDSRYYGPIR IGQIKGVIKP IWVNATSGEI       180
     A                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page