(data stored in ACNUC7421 zone)

EMBL: CP000675.PE606

CP000675.PE606       Location/Qualifiers
FT   CDS             complement(634435..635202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2796"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56697"
FT                   /protein_id="ABQ56697.1"
FT                   /translation="MDDKKLILDAANRYGFNLEFRTKKVLEEKNFSVLMNQLMKSGDEF
FT                   VEIDIRAAQYTGREWLIECKGSSDSSHLILIKEDSSNDPKSYNTKRHAIQDSNYRIAQF
FT                   KPDENQYFFTFTGDFFNKTGQQLKKISKNDSENNFFKAQYQILSAIKAISLTDTDKDKS
FT                   KDFPIIIPMIVTNAKIWVIDYNKSSEPGVSQHKWVLHKVKIKNNLFIVPKYEIEYDTIS
FT                   ILVLNIDYLDEFLGCYSYNINGEITIGNSELAK"
     MDDKKLILDA ANRYGFNLEF RTKKVLEEKN FSVLMNQLMK SGDEFVEIDI RAAQYTGREW        60
     LIECKGSSDS SHLILIKEDS SNDPKSYNTK RHAIQDSNYR IAQFKPDENQ YFFTFTGDFF       120
     NKTGQQLKKI SKNDSENNFF KAQYQILSAI KAISLTDTDK DKSKDFPIII PMIVTNAKIW       180
     VIDYNKSSEP GVSQHKWVLH KVKIKNNLFI VPKYEIEYDT ISILVLNIDY LDEFLGCYSY       240
     NINGEITIGN SELAK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page