(data stored in ACNUC7421 zone)

EMBL: CP000675.PE615

CP000675.PE615       Location/Qualifiers
FT   CDS             645773..647026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2787"
FT                   /product="hypothetical protein"
FT                   /note="similarity to Vibrio vulnificus VVA0689"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2787"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56688"
FT                   /protein_id="ABQ56688.1"
FT                   /translation="MSMESQDKFVAKRGKTYLNREELEAHLASVIRLENIGVLLGAGAS
FT                   ISAGGKTMSDVWKSFKDDYSDSADWLQKKTFFNDGSINVEELLDTLEIAEKEWIRQGKT
FT                   KLTKQLQKAKADLYRSIIKASVLQDKWWNSPHLVDLDDGKLDSHRALLQALCGSRQVGQ
FT                   PAPWIFTTNYDLAMEWAGETLGWKINNGFEGLHNRIFSPHVFDLGYSNLSARGEARFGT
FT                   YGFFLAKLHGSLSWQELDGEYLEYPAATIWSDIQNFLDKKDNHKLPIVFPSAAKYIQTV
FT                   GFVLGELLRRFTEFLSKSQTCLITIGYSFSDSHLNQIVKRALLNPTLQLVICLPELEKF
FT                   DGNNININKSIQSILKLESPQITIIGGKEKAFFDSFVTYLPQPVIYDEYALKIKKLINE
FT                   NKEQNTPAREDIGIGENM"
     MSMESQDKFV AKRGKTYLNR EELEAHLASV IRLENIGVLL GAGASISAGG KTMSDVWKSF        60
     KDDYSDSADW LQKKTFFNDG SINVEELLDT LEIAEKEWIR QGKTKLTKQL QKAKADLYRS       120
     IIKASVLQDK WWNSPHLVDL DDGKLDSHRA LLQALCGSRQ VGQPAPWIFT TNYDLAMEWA       180
     GETLGWKINN GFEGLHNRIF SPHVFDLGYS NLSARGEARF GTYGFFLAKL HGSLSWQELD       240
     GEYLEYPAAT IWSDIQNFLD KKDNHKLPIV FPSAAKYIQT VGFVLGELLR RFTEFLSKSQ       300
     TCLITIGYSF SDSHLNQIVK RALLNPTLQL VICLPELEKF DGNNININKS IQSILKLESP       360
     QITIIGGKEK AFFDSFVTYL PQPVIYDEYA LKIKKLINEN KEQNTPARED IGIGENM          417
//

If you have problems or comments...

PBIL Back to PBIL home page