(data stored in ACNUC7421 zone)

EMBL: CP000675.PE621

CP000675.PE621       Location/Qualifiers
FT   CDS             655647..655844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2780"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56682"
FT                   /protein_id="ABQ56682.1"
FT                   /translation="MEKRVFKEAEAANYICMSRSFLSQDRVNGTLANRTPGPKYIKIGR
FT                   SIRYLKDDLDAWLEQHRKCG"
     MEKRVFKEAE AANYICMSRS FLSQDRVNGT LANRTPGPKY IKIGRSIRYL KDDLDAWLEQ        60
     HRKCG                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page