(data stored in ACNUC7421 zone)

EMBL: CP000675.PE622

CP000675.PE622       Location/Qualifiers
FT   CDS             complement(655907..656674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2779"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2779"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56681"
FT                   /protein_id="ABQ56681.1"
FT                   /translation="MQIECVLLKKNISGIMCKILKSIYISLMLIVSPQIKATSDTCHPK
FT                   INPRLPQYITGYGSLIDEQSKKTTDSKAYENIPVLIKGFKRSWCAHGNLPGFNATFLSL
FT                   NENKKGTFNGVIYRVSDPKEIELYDTRETVYCRKELSAKQIKIYTKNIPEKKQVWIYYP
FT                   KSTQSDHPSREYPIVQSYVDIFIRGCIKVEEKFNIKDFAKECILTTDNWPEQHWVNDRI
FT                   YPRRPSTYEPYARKIDGLLKELLPKQFKNIRIE"
     MQIECVLLKK NISGIMCKIL KSIYISLMLI VSPQIKATSD TCHPKINPRL PQYITGYGSL        60
     IDEQSKKTTD SKAYENIPVL IKGFKRSWCA HGNLPGFNAT FLSLNENKKG TFNGVIYRVS       120
     DPKEIELYDT RETVYCRKEL SAKQIKIYTK NIPEKKQVWI YYPKSTQSDH PSREYPIVQS       180
     YVDIFIRGCI KVEEKFNIKD FAKECILTTD NWPEQHWVND RIYPRRPSTY EPYARKIDGL       240
     LKELLPKQFK NIRIE                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page