(data stored in ACNUC7421 zone)

EMBL: CP000675.PE624

CP000675.PE624       Location/Qualifiers
FT   CDS             complement(657772..658149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2776"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56679"
FT                   /protein_id="ABQ56679.1"
FT                   /translation="MFFIKYLGALIYDLIILFILFFAYTSVLLLFTHGQAIPPATRWYQ
FT                   FSLLSITLVYYYGSIRCGGQTVGMKAWRFKLTTDSNKTLSRQQIIARFFYFIPATLIAP
FT                   FCLKGNYVLLHQWTQTRFKKV"
     MFFIKYLGAL IYDLIILFIL FFAYTSVLLL FTHGQAIPPA TRWYQFSLLS ITLVYYYGSI        60
     RCGGQTVGMK AWRFKLTTDS NKTLSRQQII ARFFYFIPAT LIAPFCLKGN YVLLHQWTQT       120
     RFKKV                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page