(data stored in ACNUC7421 zone)

EMBL: CP000675.PE625

CP000675.PE625       Location/Qualifiers
FT   CDS             complement(658299..659438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2775"
FT                   /product="Predicted signal transduction protein containing
FT                   EAL and modified HD-GYP domains"
FT                   /note="COG3434"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2775"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56678"
FT                   /protein_id="ABQ56678.1"
FT                   /translation="MIAKRPIYNQQLKCVAFEILSCRNVILNEELTRQFYELIYHTDTQ
FT                   LPLFVPFSLKKLLEQFETPINNPIILKLPADEIESVYSLTELQDSLFSIALLINTPQQL
FT                   AWLNFAEYIGLTEQLMNKSDVTKVVQYSKAKNRKIIAYDLNQHVNFEKCRAMTMDYYCG
FT                   DFLLNYIAEEHTEIAANKLNVLQLIQELQKEDCDLNTITHIIQEDPLLSYQLLKLVNSV
FT                   GFSSGPSIESIDQAVARLGTINLKKWVMLFSMKNISDKPVEILESGLIRAHMAEELAKK
FT                   SSNIFSQSAYTAGLLSILDCLLNKPMPALVEQITLAEEIKNALTNKSGPLGNLLSLVIA
FT                   YEEGHWEEVTQLNINGIDLSQLYIDSLALVSQGTKIMSN"
     MIAKRPIYNQ QLKCVAFEIL SCRNVILNEE LTRQFYELIY HTDTQLPLFV PFSLKKLLEQ        60
     FETPINNPII LKLPADEIES VYSLTELQDS LFSIALLINT PQQLAWLNFA EYIGLTEQLM       120
     NKSDVTKVVQ YSKAKNRKII AYDLNQHVNF EKCRAMTMDY YCGDFLLNYI AEEHTEIAAN       180
     KLNVLQLIQE LQKEDCDLNT ITHIIQEDPL LSYQLLKLVN SVGFSSGPSI ESIDQAVARL       240
     GTINLKKWVM LFSMKNISDK PVEILESGLI RAHMAEELAK KSSNIFSQSA YTAGLLSILD       300
     CLLNKPMPAL VEQITLAEEI KNALTNKSGP LGNLLSLVIA YEEGHWEEVT QLNINGIDLS       360
     QLYIDSLALV SQGTKIMSN                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page