(data stored in ACNUC7421 zone)

EMBL: CP000675.PE629

CP000675.PE629       Location/Qualifiers
FT   CDS             662258..662980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="LPC_2771"
FT                   /product="succinate dehydrogenase iron-sulfur protein
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2771"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56674"
FT                   /protein_id="ABQ56674.1"
FT                   /translation="MADSRNVILSIYRYNPEVDAKPYMKDYEIEIPAKSDPMLLTLLER
FT                   LKAEQDPSITYRRSCREGVCGSDGMNINGTNGLACITHLSQLKTDKIVIRPLPGFPVIR
FT                   DLAVDMTQFYQQYERIEPYLQNDEVAPARERLQSPEERAQLDGLYECILCACCTSSCPS
FT                   YWWNPDKFVGPAGLLQARRFLADSRDKATQHRLDLLQDPFSVFRCRTIMNCTNVCPKGL
FT                   NPTQAIAKIRTQMLTQET"
     MADSRNVILS IYRYNPEVDA KPYMKDYEIE IPAKSDPMLL TLLERLKAEQ DPSITYRRSC        60
     REGVCGSDGM NINGTNGLAC ITHLSQLKTD KIVIRPLPGF PVIRDLAVDM TQFYQQYERI       120
     EPYLQNDEVA PARERLQSPE ERAQLDGLYE CILCACCTSS CPSYWWNPDK FVGPAGLLQA       180
     RRFLADSRDK ATQHRLDLLQ DPFSVFRCRT IMNCTNVCPK GLNPTQAIAK IRTQMLTQET       240
//

If you have problems or comments...

PBIL Back to PBIL home page