(data stored in ACNUC7421 zone)

EMBL: CP000675.PE640

CP000675.PE640       Location/Qualifiers
FT   CDS             675199..676656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2759"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5339"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2759"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56663"
FT                   /protein_id="ABQ56663.1"
FT                   /translation="MKKLTGLVIILAVLILGGYYGMGILTERTVKKTVEVINQSNGLFA
FT                   DIQQYKRGWFCSDALVKWRLHVPERVVKDDDGKLQTTPAQDYQMEMPIKIYHGPIIYAN
FT                   KQLRFGMGFAQTVFPFPEKYNQQFNELFSQDSEKPQLDLSIFVNYLNKSTVELSIPSFK
FT                   LTAKDGNGKFNWMGMDSTTSMSSNLDKVEGEIEFDGAEFSKDDTKLSLGKVISEYDLHK
FT                   TTTGLYLGQASFSLPSLAVVVKDQKMFEISELTLSSSSDIDDNLFSTHFSAALKSLFAN
FT                   GQNYGPGEVEMSLRNLDAEVLAKINEQANAMQRGTDQERQQALMAMLPELPKLFSKGAE
FT                   FEISKLSLKLPQGMIDGNLLITLPKGDNSNPFELIQKTQGNAKLKMPIEVVKQLMQQSI
FT                   MQQMAKQPEMQQALIQQLQSSQGQSNQAEPTPEQIAAMQVDKQINELEQSGLITVDGKD
FT                   YVIEMSLSEGKFTVNGKPFDPSMMKFQ"
     MKKLTGLVII LAVLILGGYY GMGILTERTV KKTVEVINQS NGLFADIQQY KRGWFCSDAL        60
     VKWRLHVPER VVKDDDGKLQ TTPAQDYQME MPIKIYHGPI IYANKQLRFG MGFAQTVFPF       120
     PEKYNQQFNE LFSQDSEKPQ LDLSIFVNYL NKSTVELSIP SFKLTAKDGN GKFNWMGMDS       180
     TTSMSSNLDK VEGEIEFDGA EFSKDDTKLS LGKVISEYDL HKTTTGLYLG QASFSLPSLA       240
     VVVKDQKMFE ISELTLSSSS DIDDNLFSTH FSAALKSLFA NGQNYGPGEV EMSLRNLDAE       300
     VLAKINEQAN AMQRGTDQER QQALMAMLPE LPKLFSKGAE FEISKLSLKL PQGMIDGNLL       360
     ITLPKGDNSN PFELIQKTQG NAKLKMPIEV VKQLMQQSIM QQMAKQPEMQ QALIQQLQSS       420
     QGQSNQAEPT PEQIAAMQVD KQINELEQSG LITVDGKDYV IEMSLSEGKF TVNGKPFDPS       480
     MMKFQ                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page