(data stored in ACNUC7421 zone)

EMBL: CP000675.PE647

CP000675.PE647       Location/Qualifiers
FT   CDS             complement(681498..683714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2750"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56656"
FT                   /protein_id="ABQ56656.1"
FT                   /translation="MSINKIEEDRDTSSDLEMKAKMYLVHRMDKARPLTVKDVHILINK
FT                   LSKDLQKNQLTLIDCQLIINLVESRFTLVKQATRYLQFFLNKLDGKSINPILIPLSNIP
FT                   FWQNEPHPFDHYRSTDQLPEKADIVIIGAGLTGASTAYHLIDAVKKRNLTVVLLDKGNP
FT                   ATEASGRNGGNFELLPENSVGIYSGLVSERFRFLKRCYPLVHPSILQIESEYHASLVFQ
FT                   FALKNRNRFKEIVRKERIYCDLAAKGWLYIAHTEEEEQAICDEVTLAAQHGERIYIWSR
FT                   KKIREQFGINSKFIGRFIPDDGTYNPFKYTCCLIKAAIKGGIKLYTFVKVQQIQSMDTE
FT                   YHQLKTNMGLLKARQVIVATNAFTSELLPELSAIKPHQSQIAITDSTPDYCKGRLITSE
FT                   DGPLYLNQPRVRSKNGLVPLLIGAGDDRPMKNPYYRKRSKKVHDLIVQQRDKYFPDLKG
FT                   KPFSTEWVGALAFTPDQLPAIGYLSPGIIIVMCCNGYGGSYTTAAGFAAAEIALTGQNP
FT                   PWLPADVFSPKRLLSDKPLFLEDSDSLWRIGKTLCTTLNNLNQLLAESLSYQSMYQPYF
FT                   TISSLPHGHQEKTCNLDPLRVMHQLAIFRTFAYQELEMLIRYTSPVCLNKGEILFKQGD
FT                   AGHSCFILIQGKINLYYEHAEGFTSMVAELEAGSVFGQMALFLENKRMATCQATENCSM
FT                   LEIMVEPCKSLFIQQQALGIKLLRLLNQGVIDALHKLNKRLKYT"
     MSINKIEEDR DTSSDLEMKA KMYLVHRMDK ARPLTVKDVH ILINKLSKDL QKNQLTLIDC        60
     QLIINLVESR FTLVKQATRY LQFFLNKLDG KSINPILIPL SNIPFWQNEP HPFDHYRSTD       120
     QLPEKADIVI IGAGLTGAST AYHLIDAVKK RNLTVVLLDK GNPATEASGR NGGNFELLPE       180
     NSVGIYSGLV SERFRFLKRC YPLVHPSILQ IESEYHASLV FQFALKNRNR FKEIVRKERI       240
     YCDLAAKGWL YIAHTEEEEQ AICDEVTLAA QHGERIYIWS RKKIREQFGI NSKFIGRFIP       300
     DDGTYNPFKY TCCLIKAAIK GGIKLYTFVK VQQIQSMDTE YHQLKTNMGL LKARQVIVAT       360
     NAFTSELLPE LSAIKPHQSQ IAITDSTPDY CKGRLITSED GPLYLNQPRV RSKNGLVPLL       420
     IGAGDDRPMK NPYYRKRSKK VHDLIVQQRD KYFPDLKGKP FSTEWVGALA FTPDQLPAIG       480
     YLSPGIIIVM CCNGYGGSYT TAAGFAAAEI ALTGQNPPWL PADVFSPKRL LSDKPLFLED       540
     SDSLWRIGKT LCTTLNNLNQ LLAESLSYQS MYQPYFTISS LPHGHQEKTC NLDPLRVMHQ       600
     LAIFRTFAYQ ELEMLIRYTS PVCLNKGEIL FKQGDAGHSC FILIQGKINL YYEHAEGFTS       660
     MVAELEAGSV FGQMALFLEN KRMATCQATE NCSMLEIMVE PCKSLFIQQQ ALGIKLLRLL       720
     NQGVIDALHK LNKRLKYT                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page