(data stored in ACNUC7421 zone)

EMBL: CP000675.PE65

CP000675.PE65        Location/Qualifiers
FT   CDS             64639..65886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0065"
FT                   /product="SdbB protein (putative substrate of the Dot/Icm
FT                   system)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54065"
FT                   /protein_id="ABQ54065.1"
FT                   /translation="MTRSKESKTENSSFFQNHLKLSVAKLLFSEGVGDWYKKKGYGAQD
FT                   TDKDFLAPFADFLKQQKTNPEATYYNAFQNLKLTLNRVPSQLVSRDSCELEVLTCEPEA
FT                   DSPQKTGTGKHIVYFPGANTYYQACFRDISAAAKETGATVHALNYPGIGMSTGEVVEAN
FT                   DLTNAGIAVVLSLLNQGVKPDDIVLQGDCFGASVALEVKNEIEKQADIKVRLIMNNAFK
FT                   SFKAAVSDLIDRSPLIPSVSKSIVKNLLEFTGWNVAPGQKYIHSDPYQCYIQHEGDQTL
FT                   TTATLSSKVAKYKEEIRTGRTTSRSRDPVIDKCPEEYKPFRDFLDENCFVRVRDSAKER
FT                   LAAKFGVDSCGEVNAHFADLCELEMLGGQSVYEGFVNNYLVMSDKYIKAHPQKDYDPDK
FT                   INFLSSNPMGYTPKSS"
     MTRSKESKTE NSSFFQNHLK LSVAKLLFSE GVGDWYKKKG YGAQDTDKDF LAPFADFLKQ        60
     QKTNPEATYY NAFQNLKLTL NRVPSQLVSR DSCELEVLTC EPEADSPQKT GTGKHIVYFP       120
     GANTYYQACF RDISAAAKET GATVHALNYP GIGMSTGEVV EANDLTNAGI AVVLSLLNQG       180
     VKPDDIVLQG DCFGASVALE VKNEIEKQAD IKVRLIMNNA FKSFKAAVSD LIDRSPLIPS       240
     VSKSIVKNLL EFTGWNVAPG QKYIHSDPYQ CYIQHEGDQT LTTATLSSKV AKYKEEIRTG       300
     RTTSRSRDPV IDKCPEEYKP FRDFLDENCF VRVRDSAKER LAAKFGVDSC GEVNAHFADL       360
     CELEMLGGQS VYEGFVNNYL VMSDKYIKAH PQKDYDPDKI NFLSSNPMGY TPKSS            415
//

If you have problems or comments...

PBIL Back to PBIL home page