(data stored in ACNUC7421 zone)

EMBL: CP000675.PE652

CP000675.PE652       Location/Qualifiers
FT   CDS             complement(687392..688012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2744"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56651"
FT                   /protein_id="ABQ56651.1"
FT                   /translation="MDIKKLKKAASNFLERYPGGFYHPEMIEMGKKHKMDKMVALAQGS
FT                   FAKQNFKNPDEITNSMLKIVTQSSLISIFEKPKFRDFIKRTPPNDKVLIAKGLKELLYG
FT                   NEQEGFEELLFQFQREKLAKWTLMTIFQAYFNPEVDVFIKPTTTKNIIKELNLDIVYNP
FT                   TPSWEFYESYRNIINQMKTKIEKSLAPSNAAFCGFLMMSLDDR"
     MDIKKLKKAA SNFLERYPGG FYHPEMIEMG KKHKMDKMVA LAQGSFAKQN FKNPDEITNS        60
     MLKIVTQSSL ISIFEKPKFR DFIKRTPPND KVLIAKGLKE LLYGNEQEGF EELLFQFQRE       120
     KLAKWTLMTI FQAYFNPEVD VFIKPTTTKN IIKELNLDIV YNPTPSWEFY ESYRNIINQM       180
     KTKIEKSLAP SNAAFCGFLM MSLDDR                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page