(data stored in ACNUC7421 zone)

EMBL: CP000675.PE660

CP000675.PE660       Location/Qualifiers
FT   CDS             693613..693906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2736"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2736"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56643"
FT                   /protein_id="ABQ56643.1"
FT                   /translation="MTQYNFERWSEMAKKIQEPFQAIAELNVKTLQGLSYLKPDELAQV
FT                   KKPEEMLKKQINLAVKNGHKALDYMQKSFQIIEKAMLGFVQEAKKTTAEVKK"
     MTQYNFERWS EMAKKIQEPF QAIAELNVKT LQGLSYLKPD ELAQVKKPEE MLKKQINLAV        60
     KNGHKALDYM QKSFQIIEKA MLGFVQEAKK TTAEVKK                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page