(data stored in ACNUC7421 zone)

EMBL: CP000675.PE662

CP000675.PE662       Location/Qualifiers
FT   CDS             695288..695893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2734"
FT                   /product="spore maturation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2734"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56641"
FT                   /protein_id="ABQ56641.1"
FT                   /translation="MLNLIWLGMILISVVVGVIEGRIDEVVRAVTDSAKLGFELALGLA
FT                   GIMTFWLGIMSVATESGLVSILGKVLKPVLKRLFPDIPVEHPAMGAMVMNIAANMLGLA
FT                   NAATPFGLQAMKELQSLNQNLKVATNSMCTFLAINTSSVQLIPVTAIAFLAANGSTNPS
FT                   SVVFTSLIATTVSTLVAIVAVKQLAKLPRFKIERTDSL"
     MLNLIWLGMI LISVVVGVIE GRIDEVVRAV TDSAKLGFEL ALGLAGIMTF WLGIMSVATE        60
     SGLVSILGKV LKPVLKRLFP DIPVEHPAMG AMVMNIAANM LGLANAATPF GLQAMKELQS       120
     LNQNLKVATN SMCTFLAINT SSVQLIPVTA IAFLAANGST NPSSVVFTSL IATTVSTLVA       180
     IVAVKQLAKL PRFKIERTDS L                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page