(data stored in ACNUC7421 zone)

EMBL: CP000675.PE678

CP000675.PE678       Location/Qualifiers
FT   CDS             complement(715609..715935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2714"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56625"
FT                   /protein_id="ABQ56625.1"
FT                   /translation="MADQYTDTALSLLSQCYDASDEINSNITHCFNEKLKKIPNPLNYK
FT                   ISVHATKTKKSDHGKITVFMINNKGIMLYCIGTAGEKLKINACASDVGKPLTPEQELSI
FT                   EGFF"
     MADQYTDTAL SLLSQCYDAS DEINSNITHC FNEKLKKIPN PLNYKISVHA TKTKKSDHGK        60
     ITVFMINNKG IMLYCIGTAG EKLKINACAS DVGKPLTPEQ ELSIEGFF                    108
//

If you have problems or comments...

PBIL Back to PBIL home page