(data stored in ACNUC7421 zone)

EMBL: CP000675.PE68

CP000675.PE68        Location/Qualifiers
FT   CDS             67713..68699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54068"
FT                   /protein_id="ABQ54068.1"
FT                   /translation="MTRIIVLTESAGIALGILGVLFSVIGFVSSTIARIFDPTASKLSR
FT                   VMSAGILIAAAAGAIPLIYLGTLFPAMWVYLGIGIMGFGVLNSSYYLYSDVRKENALIN
FT                   QYKDNPEQYVESIKEKRQAKYEKLLNTRLDDKQARVLLVFKLYQLDKKLAVAKQEGLAR
FT                   LYDIVCHRKHTRSLERFIDLGTSLTSLIVGVSVLFWGIAAWPIGPILLGISLAVFSVSL
FT                   SKSAIQFYRKVNKNNALLKEVLSNDRYISLLDANLDNPYDIEEMGTMEKTQEKVCTHEL
FT                   SQEPALSKDQEHKEHYTKLFQPVNKTALRPNDEETDELSCKSVLLQR"
     MTRIIVLTES AGIALGILGV LFSVIGFVSS TIARIFDPTA SKLSRVMSAG ILIAAAAGAI        60
     PLIYLGTLFP AMWVYLGIGI MGFGVLNSSY YLYSDVRKEN ALINQYKDNP EQYVESIKEK       120
     RQAKYEKLLN TRLDDKQARV LLVFKLYQLD KKLAVAKQEG LARLYDIVCH RKHTRSLERF       180
     IDLGTSLTSL IVGVSVLFWG IAAWPIGPIL LGISLAVFSV SLSKSAIQFY RKVNKNNALL       240
     KEVLSNDRYI SLLDANLDNP YDIEEMGTME KTQEKVCTHE LSQEPALSKD QEHKEHYTKL       300
     FQPVNKTALR PNDEETDELS CKSVLLQR                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page