(data stored in ACNUC7421 zone)

EMBL: CP000675.PE686

CP000675.PE686       Location/Qualifiers
FT   CDS             complement(720908..721591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2706"
FT                   /product="conserved hypothetical protein; transmembrane
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2706"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56617"
FT                   /protein_id="ABQ56617.1"
FT                   /translation="MRVLNSCNKVRGIFTLTQKTIKTFCFILAILVLIIFAVVFHNHSL
FT                   EIIDYIDDLGWLAPVLFLLTYCLATLLLLPTMVLTLAGGAVFGPVFGTLLNLLGATSGA
FT                   AFAFLITRHLVYDWFSTKKGEKLNKLIAGVDEKGWVFVAFLRLFPIVPFNLVNYGLGVT
FT                   GISFRLYLLTTFIFLIPAEIIYTYFGYVGMDALTRPGHLYRNGGVFLTGLAIFFLLVIR
FT                   IMKKR"
     MRVLNSCNKV RGIFTLTQKT IKTFCFILAI LVLIIFAVVF HNHSLEIIDY IDDLGWLAPV        60
     LFLLTYCLAT LLLLPTMVLT LAGGAVFGPV FGTLLNLLGA TSGAAFAFLI TRHLVYDWFS       120
     TKKGEKLNKL IAGVDEKGWV FVAFLRLFPI VPFNLVNYGL GVTGISFRLY LLTTFIFLIP       180
     AEIIYTYFGY VGMDALTRPG HLYRNGGVFL TGLAIFFLLV IRIMKKR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page