(data stored in ACNUC7421 zone)

EMBL: CP000675.PE688

CP000675.PE688       Location/Qualifiers
FT   CDS             723432..724973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2703"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56615"
FT                   /protein_id="ABQ56615.1"
FT                   /translation="MLPFLSLFFRQLYRIHVKIEDNNRIPLTYRQFLTRCFILGRQIKK
FT                   QTAIGETVGVMMPTTIAGMVTFFALQAYRRIPAMLNFSMGFYNLYSACNTARIKSIYTA
FT                   RQFIETAKLEPLVEELQQAGIRIHYLEDFKSTIHLGNKLSGIFKGFFPTLSYRFLGDKI
FT                   SPDTTGIILFTSGSEGKPKGVALSHANILANCWQMTSRVDFTPRDVLFNSLPIFHCFGL
FT                   TAGSVLPLVNGLNCFFYPSPLHYKVIPGLVYQTGATILFGTDTFLTGYARAAGKHDFNS
FT                   VRYIFAGAEKVKPETIRYWSEAFGARIYEGYGATEASPVISLNCPLASVPGSVGMILPF
FT                   MDFKVEPVEGIVQGGRLKLCGPNIMLGYLDEDKPGVIIEPEDGWHDTGDIVTVNADGFI
FT                   TIAGRAKRFAKIAGEMVSLTAVEGIAASIWPELLHAAVVQKSPRKGEQIFLFTEAEYAD
FT                   KVSFIKKVKERGQSELLVPHMIYPACQIPVLPSGKIDYITLEKQFLEQKETMETV"
     MLPFLSLFFR QLYRIHVKIE DNNRIPLTYR QFLTRCFILG RQIKKQTAIG ETVGVMMPTT        60
     IAGMVTFFAL QAYRRIPAML NFSMGFYNLY SACNTARIKS IYTARQFIET AKLEPLVEEL       120
     QQAGIRIHYL EDFKSTIHLG NKLSGIFKGF FPTLSYRFLG DKISPDTTGI ILFTSGSEGK       180
     PKGVALSHAN ILANCWQMTS RVDFTPRDVL FNSLPIFHCF GLTAGSVLPL VNGLNCFFYP       240
     SPLHYKVIPG LVYQTGATIL FGTDTFLTGY ARAAGKHDFN SVRYIFAGAE KVKPETIRYW       300
     SEAFGARIYE GYGATEASPV ISLNCPLASV PGSVGMILPF MDFKVEPVEG IVQGGRLKLC       360
     GPNIMLGYLD EDKPGVIIEP EDGWHDTGDI VTVNADGFIT IAGRAKRFAK IAGEMVSLTA       420
     VEGIAASIWP ELLHAAVVQK SPRKGEQIFL FTEAEYADKV SFIKKVKERG QSELLVPHMI       480
     YPACQIPVLP SGKIDYITLE KQFLEQKETM ETV                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page