(data stored in ACNUC7421 zone)

EMBL: CP000675.PE690

CP000675.PE690       Location/Qualifiers
FT   CDS             complement(725480..725863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2701"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56613"
FT                   /protein_id="ABQ56613.1"
FT                   /translation="MRKKNRILLASLFSLGSLNAFAAQDLTVVNTSDDLGYVTIGSYSC
FT                   ELTSSCAIPPDNSIRINSDIVEAACANTPADCEIVFGVDSIKARIATGSFSLNEGIQYI
FT                   AQSRWLNYSAKRLSKTVAEIYKR"
     MRKKNRILLA SLFSLGSLNA FAAQDLTVVN TSDDLGYVTI GSYSCELTSS CAIPPDNSIR        60
     INSDIVEAAC ANTPADCEIV FGVDSIKARI ATGSFSLNEG IQYIAQSRWL NYSAKRLSKT       120
     VAEIYKR                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page