(data stored in ACNUC7421 zone)

EMBL: CP000675.PE694

CP000675.PE694       Location/Qualifiers
FT   CDS             729999..730751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2697"
FT                   /product="ATP transporter, ABC binding component,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2697"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56609"
FT                   /protein_id="ABQ56609.1"
FT                   /translation="MLNIKELNVAVNGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSK
FT                   VLAGHPSYEVTRGDISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVN
FT                   AVRKGQGRNTLDAIEFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALE
FT                   PRLAILDETDSGLDIDALRIISQGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLANG
FT                   RIITSGDKSLALELEKKGYSWLEEVEQL"
     MLNIKELNVA VNGQSILKGI NLEVKPGEVH AIMGPNGSGK STLSKVLAGH PSYEVTRGDI        60
     SYLGQDLLPM SPEERARAGI FMSFQYPVEI PGVTNINFLK ASVNAVRKGQ GRNTLDAIEF       120
     LSFIREKCQL LDMDESFLYR SINEGFSGGE KKRNEILQMA ALEPRLAILD ETDSGLDIDA       180
     LRIISQGVNA MRSPERSIIL VTHYQRLLDY IEPDFIHVLA NGRIITSGDK SLALELEKKG       240
     YSWLEEVEQL                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page