(data stored in ACNUC7421 zone)

EMBL: CP000675.PE698

CP000675.PE698       Location/Qualifiers
FT   CDS             733786..734121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2693"
FT                   /product="metal-sulfur cluster biosynthetic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2693"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56605"
FT                   /protein_id="ABQ56605.1"
FT                   /translation="MFGFKKKQSNESIKEGVITALRGVFDPEIPVNIYDLGLIYDIAVN
FT                   DEGHVHIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELVWEPPWSQDRMTEAAR
FT                   LELGIFY"
     MFGFKKKQSN ESIKEGVITA LRGVFDPEIP VNIYDLGLIY DIAVNDEGHV HIQMTLTTPG        60
     CPVAQTFPGT VEQAVNQVEG VSDCTVELVW EPPWSQDRMT EAARLELGIF Y                111
//

If you have problems or comments...

PBIL Back to PBIL home page