(data stored in ACNUC7421 zone)

EMBL: CP000675.PE709

CP000675.PE709       Location/Qualifiers
FT   CDS             743429..744616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2681"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56594"
FT                   /protein_id="ABQ56594.1"
FT                   /translation="MIDVGKIITDLAWPISLLIAWFAGELGYRWAKLPHISIYAIVGFS
FT                   LASTQIGLLPSIQPPSILLLANIGFGLILFESGYRINLRWLSYNPWVAASSITEATLTF
FT                   CLVYILVKSFGLQTSTCLLLASLSMATSPATVVRVINEQRSSGQVTERVLHLSVINCVL
FT                   AVFLFKVIIGLVVFRTSGNLWEAAYASLTVTAISTIWGIIFGVIMPILLKTVKSTCQDN
FT                   TLAFACAVILLVILTHNLKLSPVLATLTFGLVSRHGRMVFSPSQPGFGTLGDLLSVLLF
FT                   VFIAATIEWQRVVTGVWIGLSIITVRFVAKIIGISLFAHISGISLKKGILTGLAMTPIS
FT                   VFVILILEQSRYIGINLVDTLAPLAMVALTLEILGPIMVQRALIKANEISAIKEF"
     MIDVGKIITD LAWPISLLIA WFAGELGYRW AKLPHISIYA IVGFSLASTQ IGLLPSIQPP        60
     SILLLANIGF GLILFESGYR INLRWLSYNP WVAASSITEA TLTFCLVYIL VKSFGLQTST       120
     CLLLASLSMA TSPATVVRVI NEQRSSGQVT ERVLHLSVIN CVLAVFLFKV IIGLVVFRTS       180
     GNLWEAAYAS LTVTAISTIW GIIFGVIMPI LLKTVKSTCQ DNTLAFACAV ILLVILTHNL       240
     KLSPVLATLT FGLVSRHGRM VFSPSQPGFG TLGDLLSVLL FVFIAATIEW QRVVTGVWIG       300
     LSIITVRFVA KIIGISLFAH ISGISLKKGI LTGLAMTPIS VFVILILEQS RYIGINLVDT       360
     LAPLAMVALT LEILGPIMVQ RALIKANEIS AIKEF                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page