(data stored in ACNUC7421 zone)

EMBL: CP000675.PE710

CP000675.PE710       Location/Qualifiers
FT   CDS             744618..745739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2680"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56593"
FT                   /db_xref="GOA:A5IGU3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGU3"
FT                   /protein_id="ABQ56593.1"
FT                   /translation="MPLQPFKTSNLLTMGVELELQLISLSNFDLTAASPDILELLGRSS
FT                   FPGSFTPEITESMLEIATDVHEEYDQLLKQLFHIRDALVTVGDRLNIGICGGGTHPFQM
FT                   WSDQRIFNKTRFIEVSELYGYLTKQFTIFGQHIHIGCEDGNQALFLLHSLNRYIPHFIA
FT                   LSASSPFVQSKDTLYNSARLNSVFAFPLSGRAPFVLNWDEFSLGYFEKMEHTGIVKSMK
FT                   DFYWDLRPKPEFGTIEMRVCDSPLTVERAAALACYMQALCSYLLENKEPLPHEDDYLVY
FT                   NYNRFQACRFGLDGTLVHPKTYEQILLREDILTTLRRLKPYANQLNSTMALEHIYEITH
FT                   KGSDASFLREKYAEHRTLESVVNESLKQFRRSK"
     MPLQPFKTSN LLTMGVELEL QLISLSNFDL TAASPDILEL LGRSSFPGSF TPEITESMLE        60
     IATDVHEEYD QLLKQLFHIR DALVTVGDRL NIGICGGGTH PFQMWSDQRI FNKTRFIEVS       120
     ELYGYLTKQF TIFGQHIHIG CEDGNQALFL LHSLNRYIPH FIALSASSPF VQSKDTLYNS       180
     ARLNSVFAFP LSGRAPFVLN WDEFSLGYFE KMEHTGIVKS MKDFYWDLRP KPEFGTIEMR       240
     VCDSPLTVER AAALACYMQA LCSYLLENKE PLPHEDDYLV YNYNRFQACR FGLDGTLVHP       300
     KTYEQILLRE DILTTLRRLK PYANQLNSTM ALEHIYEITH KGSDASFLRE KYAEHRTLES       360
     VVNESLKQFR RSK                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page