(data stored in ACNUC7421 zone)

EMBL: CP000675.PE711

CP000675.PE711       Location/Qualifiers
FT   CDS             complement(745804..746205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2679"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56592"
FT                   /protein_id="ABQ56592.1"
FT                   /translation="MINQQIEVFLKSPAFAVVGASSNREKYGNKVLRCYLRNGKKVYPV
FT                   NPHETLIESLPVIHSVNDLPDDVHSISIITPPSITEEVVKEAVKKGIQHIWMQPGAESD
FT                   SAIQYGLDHKLNVISGGPCILVVMGYEEN"
     MINQQIEVFL KSPAFAVVGA SSNREKYGNK VLRCYLRNGK KVYPVNPHET LIESLPVIHS        60
     VNDLPDDVHS ISIITPPSIT EEVVKEAVKK GIQHIWMQPG AESDSAIQYG LDHKLNVISG       120
     GPCILVVMGY EEN                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page