(data stored in ACNUC7421 zone)

EMBL: CP000675.PE712

CP000675.PE712       Location/Qualifiers
FT   CDS             746350..747207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2678"
FT                   /product="GTP cyclohydrolase I PLUS perhaps regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2678"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56591"
FT                   /db_xref="GOA:A5IGU1"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGU1"
FT                   /protein_id="ABQ56591.1"
FT                   /translation="MNKELESIYQNIANQSELGQTANYDSYYNPKRLYPIPRAPKRQEI
FT                   NLDPNSTTFYGFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCIIESKSLKLYFNSLN
FT                   NSTFPDVETVVQTISKDLSYCIGSEVAVNVYPLSDIPNQTIYAAFDGVCLDKLDIECSV
FT                   YHVMPDFLSTSSELVEEVLYSDLLKSNCLVTNQPDWGSVQIIYKGKKINHEGLLKYLIS
FT                   FRNHNEFHEQCIERIFADIMRFCQPESLTVYGRYTRRGGLDINPIRSTEPCAFDGQNIR
FT                   LIRQ"
     MNKELESIYQ NIANQSELGQ TANYDSYYNP KRLYPIPRAP KRQEINLDPN STTFYGFDCW        60
     NHYEVSWLNS KGKPVVAMAV ISYDCHSPCI IESKSLKLYF NSLNNSTFPD VETVVQTISK       120
     DLSYCIGSEV AVNVYPLSDI PNQTIYAAFD GVCLDKLDIE CSVYHVMPDF LSTSSELVEE       180
     VLYSDLLKSN CLVTNQPDWG SVQIIYKGKK INHEGLLKYL ISFRNHNEFH EQCIERIFAD       240
     IMRFCQPESL TVYGRYTRRG GLDINPIRST EPCAFDGQNI RLIRQ                       285
//

If you have problems or comments...

PBIL Back to PBIL home page