(data stored in ACNUC7421 zone)

EMBL: CP000675.PE713

CP000675.PE713       Location/Qualifiers
FT   CDS             747601..748692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2677"
FT                   /product="major outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2677"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56590"
FT                   /protein_id="ABQ56590.1"
FT                   /translation="MKKYHQLLMGISLLLFGVCNYAGDTGPVENSDLFRVFIPNLKPGY
FT                   EFSATAFYLQPGADNLGWGVITTVLPIPSPNWQVVTFNPDYQVGFNLGGRYVFANSGSD
FT                   LQLNWSHLRTNDTDNVFVNPSSQWISPFSQTGTPPTPSGQITGVALLKLAHASLDFSYD
FT                   AVSLDVGKFINFGSKLQTRLFTGLSSAWIKEELISTFRGFSLPILSLNNTSTYKGVGPR
FT                   LGFNNSYNISHGFNLVGQLAGSVLYGRMQPAQYQFTGTSQQLIIAGIFVNREGLANPSV
FT                   NQLVPALDAKIGLSYLYSLKQNWDLNFEAGYMGALYFNPLSSYETNTNVIALDTGSLST
FT                   SSAKHTQSNFSVGGPYITVSLRT"
     MKKYHQLLMG ISLLLFGVCN YAGDTGPVEN SDLFRVFIPN LKPGYEFSAT AFYLQPGADN        60
     LGWGVITTVL PIPSPNWQVV TFNPDYQVGF NLGGRYVFAN SGSDLQLNWS HLRTNDTDNV       120
     FVNPSSQWIS PFSQTGTPPT PSGQITGVAL LKLAHASLDF SYDAVSLDVG KFINFGSKLQ       180
     TRLFTGLSSA WIKEELISTF RGFSLPILSL NNTSTYKGVG PRLGFNNSYN ISHGFNLVGQ       240
     LAGSVLYGRM QPAQYQFTGT SQQLIIAGIF VNREGLANPS VNQLVPALDA KIGLSYLYSL       300
     KQNWDLNFEA GYMGALYFNP LSSYETNTNV IALDTGSLST SSAKHTQSNF SVGGPYITVS       360
     LRT                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page