(data stored in ACNUC7421 zone)

EMBL: CP000675.PE718

CP000675.PE718       Location/Qualifiers
FT   CDS             complement(752873..754801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2672"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2672"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56585"
FT                   /protein_id="ABQ56585.1"
FT                   /translation="MTRAQTHPHQTTVISNLKIIPLTLGWLLKFALLIIIIAVFTPLSP
FT                   KMPAPGLDASWAVGLNQAVAQGLAFGKDIFFTLGPYSSIYTKFYHPATNFMMVGGSLYL
FT                   ALCYWIAIILLMQGIKWRWSIAFAILLFSMIYARDSLFFSYSLIIGLLIHKEIPGKETS
FT                   LKSNFFTLFALLFTPFGLFPLIKGSLLILSIITILLCSFFLSLYKQRNLVVLCLASPVV
FT                   SILFFWIASGQSVFNLPAYISNTISLASGFTEAMATEGDNKELIFFGITSSCILLSILL
FT                   QKQLSPLSKAFLFCIYFVFLFLSYKTGFTRHFGHAFIAGTSVLLASFLLPYFNSNNKVI
FT                   VPLLALSLYTANYINGHYTKISVRDNFISTYTAAYYGLQNRIQNKNWLKENFSLTMNYL
FT                   KARDDFPRLPGTTDIYSYNQTSLIASGMQWSPRPIFQSYSVFTAKMAEINTNYLLSENK
FT                   PDNIIFKVEPIDNRIPSMEDGMSWPTLINHYQPVRLENDFLFLRKKLVNKPVTSLVPLK
FT                   TEIHTFGEQVKIPDTDKPLFVEIEIQPTLWGRLATTFFKPHQLEANLELKNGTQRQYRL
FT                   ISNMAKSGFLLSPLIENSAEFGLLFSQNNYLAGKKVISFSINSKQVPSSHWQTKYTIHY
FT                   KIFASNN"
     MTRAQTHPHQ TTVISNLKII PLTLGWLLKF ALLIIIIAVF TPLSPKMPAP GLDASWAVGL        60
     NQAVAQGLAF GKDIFFTLGP YSSIYTKFYH PATNFMMVGG SLYLALCYWI AIILLMQGIK       120
     WRWSIAFAIL LFSMIYARDS LFFSYSLIIG LLIHKEIPGK ETSLKSNFFT LFALLFTPFG       180
     LFPLIKGSLL ILSIITILLC SFFLSLYKQR NLVVLCLASP VVSILFFWIA SGQSVFNLPA       240
     YISNTISLAS GFTEAMATEG DNKELIFFGI TSSCILLSIL LQKQLSPLSK AFLFCIYFVF       300
     LFLSYKTGFT RHFGHAFIAG TSVLLASFLL PYFNSNNKVI VPLLALSLYT ANYINGHYTK       360
     ISVRDNFIST YTAAYYGLQN RIQNKNWLKE NFSLTMNYLK ARDDFPRLPG TTDIYSYNQT       420
     SLIASGMQWS PRPIFQSYSV FTAKMAEINT NYLLSENKPD NIIFKVEPID NRIPSMEDGM       480
     SWPTLINHYQ PVRLENDFLF LRKKLVNKPV TSLVPLKTEI HTFGEQVKIP DTDKPLFVEI       540
     EIQPTLWGRL ATTFFKPHQL EANLELKNGT QRQYRLISNM AKSGFLLSPL IENSAEFGLL       600
     FSQNNYLAGK KVISFSINSK QVPSSHWQTK YTIHYKIFAS NN                          642
//

If you have problems or comments...

PBIL Back to PBIL home page