(data stored in ACNUC7421 zone)

EMBL: CP000675.PE719

CP000675.PE719       Location/Qualifiers
FT   CDS             complement(754927..755319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2671"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56584"
FT                   /protein_id="ABQ56584.1"
FT                   /translation="MLTTFLATVIGWYLVIVSLFLLFHNEHAKSAMAEIIAHRGSQLIM
FT                   AIVTLITGLLLVVSHNIWIMGWPVVITLFAWLVLLGGLIRFLCPDTAVRVGQSFVDNPM
FT                   RLKIAAVIFFIIGLFLLFNVYYVYLK"
     MLTTFLATVI GWYLVIVSLF LLFHNEHAKS AMAEIIAHRG SQLIMAIVTL ITGLLLVVSH        60
     NIWIMGWPVV ITLFAWLVLL GGLIRFLCPD TAVRVGQSFV DNPMRLKIAA VIFFIIGLFL       120
     LFNVYYVYLK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page