(data stored in ACNUC7421 zone)

EMBL: CP000675.PE72

CP000675.PE72        Location/Qualifiers
FT   CDS             69902..71443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0072"
FT                   /product="hypothetical signaling protein"
FT                   /note="similar to sll1895"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54072"
FT                   /protein_id="ABQ54072.1"
FT                   /translation="MNKLPKWALAEKKEFKREKIQSLLIVPMEKENSLVGFMGFDIVTH
FT                   KKQWLAEDIFMLSTVADIVIQSILKSYTIIEHESIVRYFDPLTRLPNKELFVNYLQAVL
FT                   SNIEQQENCFSFLILLNIDEFHIINDAYGTPFGDQLLFIIAEKLLHILPYKAKLCRLEA
FT                   DRFLILLQGNKAEILKIADEILSMFNHVFKLNNHQVYLQARIGVTKIDNHSDNPEKLIQ
FT                   RASLAMRKARLDNIKIAIFESNTEKSVNLKLNIQAELYQAITENQLVLHYQPQFCAKTK
FT                   QIVALEALLRWMHPKKGLLYPSEFLDVLLCSDLLLPAGEWVLKTVCAQNVAWIKQGLRP
FT                   VSIAVNISEPQFRQPNFVPMLKKILTKTHMDPCLLKLEVTEQVMIDHLDETARKLHEIE
FT                   AHNIQIILDDFGTGYASLSYLHQLPISKLKIDKSFIKNMLTNKNAAMITKTIILLAKGL
FT                   GIKSLAEGVETKEQFDILKQLGCDEIQGYYFSEPLPVEKIALFLQDGSTPNKGAF"
     MNKLPKWALA EKKEFKREKI QSLLIVPMEK ENSLVGFMGF DIVTHKKQWL AEDIFMLSTV        60
     ADIVIQSILK SYTIIEHESI VRYFDPLTRL PNKELFVNYL QAVLSNIEQQ ENCFSFLILL       120
     NIDEFHIIND AYGTPFGDQL LFIIAEKLLH ILPYKAKLCR LEADRFLILL QGNKAEILKI       180
     ADEILSMFNH VFKLNNHQVY LQARIGVTKI DNHSDNPEKL IQRASLAMRK ARLDNIKIAI       240
     FESNTEKSVN LKLNIQAELY QAITENQLVL HYQPQFCAKT KQIVALEALL RWMHPKKGLL       300
     YPSEFLDVLL CSDLLLPAGE WVLKTVCAQN VAWIKQGLRP VSIAVNISEP QFRQPNFVPM       360
     LKKILTKTHM DPCLLKLEVT EQVMIDHLDE TARKLHEIEA HNIQIILDDF GTGYASLSYL       420
     HQLPISKLKI DKSFIKNMLT NKNAAMITKT IILLAKGLGI KSLAEGVETK EQFDILKQLG       480
     CDEIQGYYFS EPLPVEKIAL FLQDGSTPNK GAF                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page