(data stored in ACNUC7421 zone)

EMBL: CP000675.PE720

CP000675.PE720       Location/Qualifiers
FT   CDS             755456..755833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2670"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2670"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56583"
FT                   /protein_id="ABQ56583.1"
FT                   /translation="MMKKINLFKLLMIFVLGTSALQAAGLSTQRIEQLSNARVTVWKTI
FT                   IYPSSKQVLPMHRHDNDRVLVALTDGTLKITNNKGKVHYLKLKKGKSYYLTKDVPNELH
FT                   NDENVTNHSIQVMVIQLNDKA"
     MMKKINLFKL LMIFVLGTSA LQAAGLSTQR IEQLSNARVT VWKTIIYPSS KQVLPMHRHD        60
     NDRVLVALTD GTLKITNNKG KVHYLKLKKG KSYYLTKDVP NELHNDENVT NHSIQVMVIQ       120
     LNDKA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page