(data stored in ACNUC7421 zone)

EMBL: CP000675.PE721

CP000675.PE721       Location/Qualifiers
FT   CDS             756034..757341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2669"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /note="COG0457"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2669"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56582"
FT                   /protein_id="ABQ56582.1"
FT                   /translation="MHTQRGLEVTTGSIEAVDSINYFHEQVLSSGQNAIQILDSAKKHT
FT                   DNLLIQTYAAAFYLYAQEDVANEQASDYLQSASRLLTSANEREKLTFEAVTNWSKRDYA
FT                   NAISLLVTLLERYPRDTLALKFVEWLFYCTGQAFNAEYFLKVCDKCAPENQDESHFLAI
FT                   HSFALELCGQYSKAREMAEEAITMNLHTPWAHHTLAHVHLLTSDITGGINRLRDLQKTW
FT                   EDILPLLKGHNTWHLALFYLANRDEEEVKKLYPHISGALPDTVLEQLDTISLLWRMDMA
FT                   GLPQDRLLNQVVDHLSTHPLEFYTGFTNAHFIYCLVKSGYKNEADESLKRMKSYACAPS
FT                   SDALWGDVVLPLCQGIYAFADADYKTALMLMEPVIGECAQLGGSDAQIELFFQTYLLVL
FT                   IHTNQKDKALQFFTEHLKYYNNTPLSDWWFQSANKT"
     MHTQRGLEVT TGSIEAVDSI NYFHEQVLSS GQNAIQILDS AKKHTDNLLI QTYAAAFYLY        60
     AQEDVANEQA SDYLQSASRL LTSANEREKL TFEAVTNWSK RDYANAISLL VTLLERYPRD       120
     TLALKFVEWL FYCTGQAFNA EYFLKVCDKC APENQDESHF LAIHSFALEL CGQYSKAREM       180
     AEEAITMNLH TPWAHHTLAH VHLLTSDITG GINRLRDLQK TWEDILPLLK GHNTWHLALF       240
     YLANRDEEEV KKLYPHISGA LPDTVLEQLD TISLLWRMDM AGLPQDRLLN QVVDHLSTHP       300
     LEFYTGFTNA HFIYCLVKSG YKNEADESLK RMKSYACAPS SDALWGDVVL PLCQGIYAFA       360
     DADYKTALML MEPVIGECAQ LGGSDAQIEL FFQTYLLVLI HTNQKDKALQ FFTEHLKYYN       420
     NTPLSDWWFQ SANKT                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page