(data stored in ACNUC7421 zone)

EMBL: CP000675.PE725

CP000675.PE725       Location/Qualifiers
FT   CDS             complement(763665..764177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2665"
FT                   /product="Tfp pilus assembly protein PilX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2665"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56578"
FT                   /protein_id="ABQ56578.1"
FT                   /translation="MNVSSTNQYSKQRGYVLITSLVLMSMLTVLALTQISQNTSQTRIA
FT                   TNATDSEISFEKTEGAINEAINLIINGTYNPQSFLASNNGMYLFDQSATTPLWKTINWS
FT                   SGSAVINSFQGNTGAQASYYLEKLPSVIMPGQSMKKPSNVYRITARSSGASGDTSVLIQ
FT                   STIQIQQ"
     MNVSSTNQYS KQRGYVLITS LVLMSMLTVL ALTQISQNTS QTRIATNATD SEISFEKTEG        60
     AINEAINLII NGTYNPQSFL ASNNGMYLFD QSATTPLWKT INWSSGSAVI NSFQGNTGAQ       120
     ASYYLEKLPS VIMPGQSMKK PSNVYRITAR SSGASGDTSV LIQSTIQIQQ                  170
//

If you have problems or comments...

PBIL Back to PBIL home page