(data stored in ACNUC7421 zone)

EMBL: CP000675.PE727

CP000675.PE727       Location/Qualifiers
FT   CDS             complement(765238..765777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2663"
FT                   /product="type IV fimbrial biogenesis protein PilV"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2663"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56576"
FT                   /protein_id="ABQ56576.1"
FT                   /translation="MINRMDTLAKDKGMTLLEVLISVVILAVGMLGIASMLIVSNKANN
FT                   SSYAKLQAVQAVYDIFDRIRANSDAASNGSYNVSNIGSNGYPTSVSAPSVLCNASVCNP
FT                   NQLAQYDTWYWLTRVVSQLPNGSGSITSALSGVAGNTVITVTVQWDDSKAQNELGASSA
FT                   SSGTANFVQFRVQSQI"
     MINRMDTLAK DKGMTLLEVL ISVVILAVGM LGIASMLIVS NKANNSSYAK LQAVQAVYDI        60
     FDRIRANSDA ASNGSYNVSN IGSNGYPTSV SAPSVLCNAS VCNPNQLAQY DTWYWLTRVV       120
     SQLPNGSGSI TSALSGVAGN TVITVTVQWD DSKAQNELGA SSASSGTANF VQFRVQSQI        179
//

If you have problems or comments...

PBIL Back to PBIL home page