(data stored in ACNUC7421 zone)

EMBL: CP000675.PE73

CP000675.PE73        Location/Qualifiers
FT   CDS             71496..71957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54073"
FT                   /protein_id="ABQ54073.1"
FT                   /translation="MPQKDCILNLPGYSIKKVGGENPVKRLSQTRAWYRVERRQSFIKA
FT                   HERSVENALIIHVRDFLIELGQGFAFVGSQVLLTFDDQLRKPGNNQTIGILLCKSKNKV
FT                   MAEYALRNISAPIGVSEYTLSKSIPTDLKGSLLTIEEIEAELNESVKED"
     MPQKDCILNL PGYSIKKVGG ENPVKRLSQT RAWYRVERRQ SFIKAHERSV ENALIIHVRD        60
     FLIELGQGFA FVGSQVLLTF DDQLRKPGNN QTIGILLCKS KNKVMAEYAL RNISAPIGVS       120
     EYTLSKSIPT DLKGSLLTIE EIEAELNESV KED                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page