(data stored in ACNUC7421 zone)

EMBL: CP000675.PE731

CP000675.PE731       Location/Qualifiers
FT   CDS             769395..770876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2659"
FT                   /product="melitin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2659"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56572"
FT                   /protein_id="ABQ56572.1"
FT                   /translation="MSFQTDKEIQQKFFSYTLFVLVVLLICRLIANYFFPLFDTTESRY
FT                   AEIARKMLETGNWVTLQQDYGVPFWAKPPLSIWLSAFFMQLLGVNEFAVRLPGLLLSVG
FT                   VLWLVWGVAKKQSGSMAALFSLLTLAGSLYFFLDAGTVMTDPALLFCTTLASVSFWHAM
FT                   VYENKIWSYAFFAGLGLGLLAKGPIAVVLVGMVVFFWVLLRNEWLNLWKRLPWFKGTFL
FT                   LLLIAMPWYVLAELRTPGFLNYFILGEHFHRFLTPGWSGDKYGIVHHVPKGTIWLYAIA
FT                   GIFPWNIIAGGWLVKHGKMLPSLCQSEDGWLSYLTLWMITPLLFFTFASNIIYPYVFPS
FT                   LPAFALLFAEILNRLNLELKHLKWVLISSLLCGVLFLAVAFVLGLKPDVVPNTHKPIIT
FT                   AWLNQNPTAGSHLVYWGYKTDFSAEFYSEGQVKSVKNQNDLCKLLSNRLENYLVINSKE
FT                   TQQIPGELLARLTLIDTFRVHRDTLILFHAPVLTC"
     MSFQTDKEIQ QKFFSYTLFV LVVLLICRLI ANYFFPLFDT TESRYAEIAR KMLETGNWVT        60
     LQQDYGVPFW AKPPLSIWLS AFFMQLLGVN EFAVRLPGLL LSVGVLWLVW GVAKKQSGSM       120
     AALFSLLTLA GSLYFFLDAG TVMTDPALLF CTTLASVSFW HAMVYENKIW SYAFFAGLGL       180
     GLLAKGPIAV VLVGMVVFFW VLLRNEWLNL WKRLPWFKGT FLLLLIAMPW YVLAELRTPG       240
     FLNYFILGEH FHRFLTPGWS GDKYGIVHHV PKGTIWLYAI AGIFPWNIIA GGWLVKHGKM       300
     LPSLCQSEDG WLSYLTLWMI TPLLFFTFAS NIIYPYVFPS LPAFALLFAE ILNRLNLELK       360
     HLKWVLISSL LCGVLFLAVA FVLGLKPDVV PNTHKPIITA WLNQNPTAGS HLVYWGYKTD       420
     FSAEFYSEGQ VKSVKNQNDL CKLLSNRLEN YLVINSKETQ QIPGELLARL TLIDTFRVHR       480
     DTLILFHAPV LTC                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page