(data stored in ACNUC7421 zone)

EMBL: CP000675.PE738

CP000675.PE738       Location/Qualifiers
FT   CDS             777751..779325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2651"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56565"
FT                   /protein_id="ABQ56565.1"
FT                   /translation="MKTQRIIHPNIDIRKFPEVNANFSMTDISMGDLHANALLFLNILV
FT                   RQGIIAISPENYAKFAEIYILPELQADYWGTEAPVFSAGNKQERLEEIKKQYNALIAQI
FT                   KIINTKKLIRLIGDELVDRGVIDYFILKLLQALHDQGADFEILLSNHGIEFVEACELFK
FT                   ENGNKLVAKRLGNIQHGNSFHALQEAIAAGSISNEEVLNIYHQVYKKHLKIISYALDPD
FT                   ANEIKVFSHAGIGLNHIRGLTRKFKVPYSEESAVDLARTIDAINKKFAEKASAGEIHTL
FT                   YTHDMMYRGYAGEYLNSTDEVVAATVWGREYGDLIRTSKKFKVTFIHGHDSYDPEKVEH
FT                   VTLNNQLGQFQNNVGDLYLYATNGMRAVPTQCLNPDKKVQSLREKNRPDKPNDYVVKVH
FT                   HTKPSFFKTAHPKMTFPDSYKRIWDSTPGHSNITKIKALLKDYTKEDSILGSFWGLIFT
FT                   LHWGRHHVKSVHQIAQTQYTSVEAILSDLKALKPREGGSLDKRIKFIESQIITQKVNNP
FT                   ELQFKLK"
     MKTQRIIHPN IDIRKFPEVN ANFSMTDISM GDLHANALLF LNILVRQGII AISPENYAKF        60
     AEIYILPELQ ADYWGTEAPV FSAGNKQERL EEIKKQYNAL IAQIKIINTK KLIRLIGDEL       120
     VDRGVIDYFI LKLLQALHDQ GADFEILLSN HGIEFVEACE LFKENGNKLV AKRLGNIQHG       180
     NSFHALQEAI AAGSISNEEV LNIYHQVYKK HLKIISYALD PDANEIKVFS HAGIGLNHIR       240
     GLTRKFKVPY SEESAVDLAR TIDAINKKFA EKASAGEIHT LYTHDMMYRG YAGEYLNSTD       300
     EVVAATVWGR EYGDLIRTSK KFKVTFIHGH DSYDPEKVEH VTLNNQLGQF QNNVGDLYLY       360
     ATNGMRAVPT QCLNPDKKVQ SLREKNRPDK PNDYVVKVHH TKPSFFKTAH PKMTFPDSYK       420
     RIWDSTPGHS NITKIKALLK DYTKEDSILG SFWGLIFTLH WGRHHVKSVH QIAQTQYTSV       480
     EAILSDLKAL KPREGGSLDK RIKFIESQII TQKVNNPELQ FKLK                        524
//

If you have problems or comments...

PBIL Back to PBIL home page