(data stored in ACNUC7421 zone)

EMBL: CP000675.PE740

CP000675.PE740       Location/Qualifiers
FT   CDS             781146..800015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2649"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56563"
FT                   /protein_id="ABQ56563.1"
FT                   /translation="MLAESVIGIVRAVNGLLEKVNVQGQASLVKSGARLEEGDVLTLLS
FT                   GEAYIQFINGFPEALALEKPVKLDGVSPTLQYGAEDLKEQMVQEAIAKGIDPSVILDVL
FT                   GSAAAGAEAVGSGGDAFIMDPLFGFGHVTAGYPTGPISFAYEADTQQLFWFVPEETGAI
FT                   AESELTQEPESIPQIPQFTTNQAVLTVFEDALPSGIPDSAGQARIASSSLSTLLTSSPD
FT                   VVASFAFNTNLSVLPTLKSGGIDLDYNLSSDKRTLTASIPGGAAVMQFELTADGQLTQT
FT                   LMDSIDHPTADSDDSEWMRLDLSPLIDVTFTRTSDGSVLESRTLPANAVVAGIQDDVPI
FT                   ARAQLTNNEILLDETIGMKAGDADAANDDFNPTTTVDPFNNTYGIPIGLVQNANLLDTS
FT                   TSEMGGDYKNATMTHLLKITDAVSGLQTTDGTPINLFLESNGDISGRAGDIGAPAVFAI
FT                   RMNPNTGAITVAQYGSIKQFDTNSHDEAVDLTGRISAVVRVTDGDGDVSNAEIPIGQRI
FT                   VFEDDGPIAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDMAGFAQSSGA
FT                   VVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDAGGDAVF
FT                   AIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVATQAIGIG
FT                   DAIVFEDDGPVAQIAATGVKVTHDETAGVNAGSDDVASPLALFAGVSQKSTDMAGFAQS
FT                   SGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDAGGD
FT                   AVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVATQAI
FT                   GIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDMAGF
FT                   AQSSGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDA
FT                   GGDAVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVAT
FT                   QAIGIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDM
FT                   AGFAQSSGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVG
FT                   RDAGGDAVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGD
FT                   VATQAIGIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLSVFVGVVNKS
FT                   TDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGL
FT                   VVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDG
FT                   DGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVV
FT                   NKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLE
FT                   SGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTV
FT                   TDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAGSNDVAGPLSVFA
FT                   GVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITL
FT                   TLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAV
FT                   VTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVASPLS
FT                   VFVGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDA
FT                   ITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKI
FT                   NAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAG
FT                   PLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTD
FT                   GDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLG
FT                   GKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSND
FT                   VAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQ
FT                   TTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAV
FT                   NLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAG
FT                   SNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAAS
FT                   GLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYD
FT                   EAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGL
FT                   DAGSNDVASPLSVFVGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIAN
FT                   AASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGS
FT                   SYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGAKVIHDET
FT                   TGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLA
FT                   IANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPT
FT                   GGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGAKVIH
FT                   DETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKF
FT                   SLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIK
FT                   HPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAK
FT                   VIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGAT
FT                   IKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYE
FT                   SIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAAT
FT                   GAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNE
FT                   GATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVA
FT                   QYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQI
FT                   AATGTKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQ
FT                   DNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVL
FT                   SVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPV
FT                   AQIAATGTKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSV
FT                   TGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADT
FT                   GVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDD
FT                   GPVAQIAATGAKVIHDETTGLDAGSNDVASPLSVFVGVVNKSTDMAGFAQSSGAVVSSA
FT                   GSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISID
FT                   ADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVF
FT                   EDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVV
FT                   SSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAI
FT                   SIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDA
FT                   IVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSG
FT                   AVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAV
FT                   LAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGI
FT                   GDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQ
FT                   SSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASG
FT                   KAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQA
FT                   IGIGDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAG
FT                   FAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRD
FT                   ASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVA
FT                   TQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTD
FT                   MAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVV
FT                   GRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDG
FT                   DVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNK
FT                   STDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESG
FT                   LVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTD
FT                   GDGDVATQAIGIGDKVVFEDDGPVASNITRSGLANEGADTNLMLILDTSGSMAGSGIQT
FT                   LINSTLELLERYEALGNVKVRIVTFNTSATAIGSVWMTVDAAKNALLGLTAGGNTNFDA
FT                   ALITAMNAFNSGTVGGADGRIGGAQNVSYFISDGNPTVNQDWPSIPGTLAQNGIQPSEQ
FT                   AAWEAFLQDTNGASAGGEKIRSYALGMGTGITVSNLEPIGFNGVNGTDIPAVVVTDISQ
FT                   LDSVLASTITASPISGTLISDPNPGVNFGADGGHVQSVTVNGITYTVNANLSSLSTSGS
FT                   ATQGSNTHSYDNSTHVLTVTISTGESLTIDMDNGSYTFTPPANITSSINRIINYVLVDG
FT                   DGDTAAATITFNIDISGFNDPLVVRDDLVLTNQPAVSGQDVISIPTWALLANDTGGSGV
FT                   SSVSSVTQPVAEGTVVLNAGSVAFTEESNSAADGTYNGSTSDPFRYTNTTGSQSATAKV
FT                   DLDRTQAGENRLDGTYRSEILLGRDTSNDTIIGNDGNDILIGLGGNDTLSGGNGDDILA
FT                   GGAGNDTLDGGAGNDTATYIDATAGVTVSLNTSSAQNTVGAGTDTLTNIENLTGSKFND
FT                   TLTGNNSANTIKGLEGNDTISGLGGNDTLDGGSGDDVIIGGLGDDILTGGSGADQFVLV
FT                   KGQGGASAGAAPIDTITDFEVNIDKIVINGNNITGVSVSTPVSNTYTITVNYSDAATEH
FT                   FKVTLSNGAVLNDSGKTHLNGVVISGGTATIDGTIVGAVLYLDLNANNQEDEGERLGIT
FT                   NQYGHVEWVVDLSKFDVNGDGQYVIGEARAVQTGGFDIDTGLSYEINLYGPVGSAVISP
FT                   LTSLLQAQLEAGMDYETANAALVARLGLPEGTQIISFNPITGSGEVLAQNAGVMTAAIQ
FT                   FAEIAAIHYSTDEGHVSFAVFEAISKALLELPEGVVADFGDEGFLQSISNYLGLDALVT
FT                   SDMIDYMATSQKALEASILTLAPGEDALTAISKIQHVTQGIYAQAIEMALIGYLPLDAL
FT                   KNMSAVLKAYADGDITDEQLNSFEDKLSAVIVNWEDNNVTDTSHQATLQTERTVDDSSV
FT                   KSEVNHEMAQEVNAVINDFMDEHNISLYYYDQQAQMPQEAQQPTEDQAEETVMHDDVVQ
FT                   DLLLDDHSLTMLANNPELNGGNGNDILHGTTGNDFIRGGQGNDTMTGGGGVDTFFWLSG
FT                   DDDGGVDTITDFKANPVDKSSDASVLNLSDLLSDADLETNSLDNYLNVSTTEEGDTAIK
FT                   VDPNGNGNFDAPAQTIILEDVDLTAVFATNNSHDIVNQMIANGNLIVEQ"
     MLAESVIGIV RAVNGLLEKV NVQGQASLVK SGARLEEGDV LTLLSGEAYI QFINGFPEAL        60
     ALEKPVKLDG VSPTLQYGAE DLKEQMVQEA IAKGIDPSVI LDVLGSAAAG AEAVGSGGDA       120
     FIMDPLFGFG HVTAGYPTGP ISFAYEADTQ QLFWFVPEET GAIAESELTQ EPESIPQIPQ       180
     FTTNQAVLTV FEDALPSGIP DSAGQARIAS SSLSTLLTSS PDVVASFAFN TNLSVLPTLK       240
     SGGIDLDYNL SSDKRTLTAS IPGGAAVMQF ELTADGQLTQ TLMDSIDHPT ADSDDSEWMR       300
     LDLSPLIDVT FTRTSDGSVL ESRTLPANAV VAGIQDDVPI ARAQLTNNEI LLDETIGMKA       360
     GDADAANDDF NPTTTVDPFN NTYGIPIGLV QNANLLDTST SEMGGDYKNA TMTHLLKITD       420
     AVSGLQTTDG TPINLFLESN GDISGRAGDI GAPAVFAIRM NPNTGAITVA QYGSIKQFDT       480
     NSHDEAVDLT GRISAVVRVT DGDGDVSNAE IPIGQRIVFE DDGPIAQIAA TGVKVTHDET       540
     AGVDAGSDDV ASPLALFAGV SQKSTDMAGF AQSSGAVVSS AGSLVGQDNE GATIKFSLAI       600
     ANAASGLQTT DGDAITLTLE SGFVVGRDAG GDAVFAIAID ADTGVLSLAQ YESIKHPSGG       660
     ASYDEAVDLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGVKVTHDET       720
     AGVNAGSDDV ASPLALFAGV SQKSTDMAGF AQSSGAVVSS AGSLVGQDNE GATIKFSLAI       780
     ANAASGLQTT DGDAITLTLE SGFVVGRDAG GDAVFAIAID ADTGVLSLAQ YESIKHPSGG       840
     ASYDEAVDLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGVKVTHDET       900
     AGVDAGSDDV ASPLALFAGV SQKSTDMAGF AQSSGAVVSS AGSLVGQDNE GATIKFSLAI       960
     ANAASGLQTT DGDAITLTLE SGFVVGRDAG GDAVFAIAID ADTGVLSLAQ YESIKHPSGG      1020
     ASYDEAVDLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGVKVTHDET      1080
     AGVDAGSDDV ASPLALFAGV SQKSTDMAGF AQSSGAVVSS AGSLVGQDNE GATIKFSLAI      1140
     ANAASGLQTT DGDAITLTLE SGFVVGRDAG GDAVFAIAID ADTGVLSLAQ YESIKHPSGG      1200
     ASYDEAVDLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGVKVTHDET      1260
     AGVDAGSDDV ASPLSVFVGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      1320
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      1380
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      1440
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      1500
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      1560
     ASYDEAVNLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGTKVIHDET      1620
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS TGSVTGQDNE GATIKFSLAI      1680
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      1740
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      1800
     TGLDAGSNDV ASPLSVFVGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      1860
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      1920
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      1980
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      2040
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      2100
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      2160
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      2220
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      2280
     ASYDEAVNLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGTKVIHDET      2340
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS TGSVTGQDNE GATIKFSLAI      2400
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      2460
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      2520
     TGLDAGSNDV ASPLSVFVGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      2580
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      2640
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGAKVIHDET      2700
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      2760
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      2820
     ASYDEAVNLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGAKVIHDET      2880
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS TGSVTGQDNE GATIKFSLAI      2940
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      3000
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      3060
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      3120
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      3180
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      3240
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      3300
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      3360
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGTKVIHDET      3420
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS TGSVTGQDNE GATIKFSLAI      3480
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      3540
     ASYDEAVNLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGTKVIHDET      3600
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS TGSVTGQDNE GATIKFSLAI      3660
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      3720
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      3780
     TGLDAGSNDV ASPLSVFVGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      3840
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      3900
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGAKVIHDET      3960
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      4020
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      4080
     ASYDEAVNLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGAKVIHDET      4140
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS TGSVTGQDNE GATIKFSLAI      4200
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      4260
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGAKVIHDET      4320
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      4380
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      4440
     ASYDEAVNLS GKINAVVTVT DGDGDVATQA IGIGDAIVFE DDGPVAQIAA TGAKVIHDET      4500
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS TGSVTGQDNE GATIKFSLAI      4560
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      4620
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      4680
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS TGSVTGQDNE GATIKFSLAI      4740
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      4800
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVAQIAA TGAKVIHDET      4860
     TGLDAGSNDV AGPLSVFAGV VNKSTDMAGF AQSSGAVVSS AGSVTGQDNE GATIKFSLAI      4920
     ANAASGLQTT DGDAITLTLE SGLVVGRDAS GKAVLAISID ADTGVLSVAQ YESIKHPTGG      4980
     SSYDEAVHLG GKINAVVTVT DGDGDVATQA IGIGDKVVFE DDGPVASNIT RSGLANEGAD      5040
     TNLMLILDTS GSMAGSGIQT LINSTLELLE RYEALGNVKV RIVTFNTSAT AIGSVWMTVD      5100
     AAKNALLGLT AGGNTNFDAA LITAMNAFNS GTVGGADGRI GGAQNVSYFI SDGNPTVNQD      5160
     WPSIPGTLAQ NGIQPSEQAA WEAFLQDTNG ASAGGEKIRS YALGMGTGIT VSNLEPIGFN      5220
     GVNGTDIPAV VVTDISQLDS VLASTITASP ISGTLISDPN PGVNFGADGG HVQSVTVNGI      5280
     TYTVNANLSS LSTSGSATQG SNTHSYDNST HVLTVTISTG ESLTIDMDNG SYTFTPPANI      5340
     TSSINRIINY VLVDGDGDTA AATITFNIDI SGFNDPLVVR DDLVLTNQPA VSGQDVISIP      5400
     TWALLANDTG GSGVSSVSSV TQPVAEGTVV LNAGSVAFTE ESNSAADGTY NGSTSDPFRY      5460
     TNTTGSQSAT AKVDLDRTQA GENRLDGTYR SEILLGRDTS NDTIIGNDGN DILIGLGGND      5520
     TLSGGNGDDI LAGGAGNDTL DGGAGNDTAT YIDATAGVTV SLNTSSAQNT VGAGTDTLTN      5580
     IENLTGSKFN DTLTGNNSAN TIKGLEGNDT ISGLGGNDTL DGGSGDDVII GGLGDDILTG      5640
     GSGADQFVLV KGQGGASAGA APIDTITDFE VNIDKIVING NNITGVSVST PVSNTYTITV      5700
     NYSDAATEHF KVTLSNGAVL NDSGKTHLNG VVISGGTATI DGTIVGAVLY LDLNANNQED      5760
     EGERLGITNQ YGHVEWVVDL SKFDVNGDGQ YVIGEARAVQ TGGFDIDTGL SYEINLYGPV      5820
     GSAVISPLTS LLQAQLEAGM DYETANAALV ARLGLPEGTQ IISFNPITGS GEVLAQNAGV      5880
     MTAAIQFAEI AAIHYSTDEG HVSFAVFEAI SKALLELPEG VVADFGDEGF LQSISNYLGL      5940
     DALVTSDMID YMATSQKALE ASILTLAPGE DALTAISKIQ HVTQGIYAQA IEMALIGYLP      6000
     LDALKNMSAV LKAYADGDIT DEQLNSFEDK LSAVIVNWED NNVTDTSHQA TLQTERTVDD      6060
     SSVKSEVNHE MAQEVNAVIN DFMDEHNISL YYYDQQAQMP QEAQQPTEDQ AEETVMHDDV      6120
     VQDLLLDDHS LTMLANNPEL NGGNGNDILH GTTGNDFIRG GQGNDTMTGG GGVDTFFWLS      6180
     GDDDGGVDTI TDFKANPVDK SSDASVLNLS DLLSDADLET NSLDNYLNVS TTEEGDTAIK      6240
     VDPNGNGNFD APAQTIILED VDLTAVFATN NSHDIVNQMI ANGNLIVEQ                  6289
//

If you have problems or comments...

PBIL Back to PBIL home page