(data stored in ACNUC7421 zone)

EMBL: CP000675.PE742

CP000675.PE742       Location/Qualifiers
FT   CDS             801075..801293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2647"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56561"
FT                   /protein_id="ABQ56561.1"
FT                   /translation="MVPADAKLLKQAKSLRKRSTDAENCLWYYLRAHRLKGYKFKRQVP
FT                   IGNYIVNFVCIQRKLIVELDGGQHLSK"
     MVPADAKLLK QAKSLRKRST DAENCLWYYL RAHRLKGYKF KRQVPIGNYI VNFVCIQRKL        60
     IVELDGGQHL SK                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page