(data stored in ACNUC7421 zone)

EMBL: CP000675.PE744

CP000675.PE744       Location/Qualifiers
FT   CDS             802257..803027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2645"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56559"
FT                   /protein_id="ABQ56559.1"
FT                   /translation="MFKLASWNVNSLKVRLEQVLQWLESSQVDVLAMQETKLTDDNFPV
FT                   ASFTDKGYHVIFSGQKTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKGIRLINL
FT                   YVPNGGELTSDKYQYKLDWLKKVTRFIQHQLSIYSKVAVVGDFNIAPEDRDVHDPVEWE
FT                   GCVLVSPAERQAFMEILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLS
FT                   HELNALCRQSKIDKEPRKAERPSDHAPVWVELEL"
     MFKLASWNVN SLKVRLEQVL QWLESSQVDV LAMQETKLTD DNFPVASFTD KGYHVIFSGQ        60
     KTYNGVAIIS RYPMTDIQTD IPELEDPQRR ILAATVKGIR LINLYVPNGG ELTSDKYQYK       120
     LDWLKKVTRF IQHQLSIYSK VAVVGDFNIA PEDRDVHDPV EWEGCVLVSP AERQAFMEIL       180
     ELGLHDSFRN FAQEEKAFSW WDYRAAAFRR NRGLRIDHVL LSHELNALCR QSKIDKEPRK       240
     AERPSDHAPV WVELEL                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page