(data stored in ACNUC7421 zone)

EMBL: CP000675.PE745

CP000675.PE745       Location/Qualifiers
FT   CDS             803164..803391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2644"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56558"
FT                   /db_xref="GOA:A5IGQ8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGQ8"
FT                   /protein_id="ABQ56558.1"
FT                   /translation="MKASVHPDYQTVKVTCSCGEVFETRSTLCKDLNIEVCSMCHPFYT
FT                   GKQKLVDTGGRVQKFRDRYNMRTGQAKSKE"
     MKASVHPDYQ TVKVTCSCGE VFETRSTLCK DLNIEVCSMC HPFYTGKQKL VDTGGRVQKF        60
     RDRYNMRTGQ AKSKE                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page