(data stored in ACNUC7421 zone)

EMBL: CP000675.PE753

CP000675.PE753       Location/Qualifiers
FT   CDS             812053..817260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2635"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56550"
FT                   /protein_id="ABQ56550.1"
FT                   /translation="MKIPVQLKNIGGNIPENDIALQVSYFIKSQNDELLPQSDAYIAPA
FT                   SGKIDVSFGNNLARNKDVFFAVALKSNNILAQTSTSATQLKDEVPITMEFDYSPLVLSE
FT                   PDDQIVSPRPLFVYGRLLDKQGKKKLEDVQIIFEATRANDGGLQPIASVRTEADGYFFI
FT                   EYPQGSFIDASARVGLPLRENPIPVRLDEVRIDGDISNKVFPRNVILVAELMEAEEATV
FT                   EKECGCEVLDVHESKRILEEYSFYSVVRTTEPEILGYVLKEEDEITLDEVLTQHPIRIW
FT                   EIIDPIFQLPAFSHLANRARVNLPEVTERSINTEITTRAHGRANTAPNPPQDNELAETL
FT                   KQIKINRGVLNNFLQRETNITKDNIVNLIEMNESYRFKQKMTLGETKPLGRVVLNSENS
FT                   VDWDLEPTLYQAVSVAHGHLLHFKSEWIADGYSLGDLLYSLPLAPGQKKQIVVFDWERR
FT                   ESATNIQSLEYEESLYNSLSRDRDIFEITKGVIEENIKGKSSATTASASAGIGGVVGGL
FT                   LFGVSGGVGHSGSTASQNSLRQTSASDLQKIRDRIVQSANAVRSQRSSVIQTVSQGERF
FT                   EVSSETVANYNHCHAITIQYYEVLRHFKVRQRFAEARECLFVPLLMSQFELNKLLRWRE
FT                   SLQFALLNTNLSKGFDAAERIKNKWIGSNFPGGTFASEKILNASGNFQIKFIIRRPDDK
FT                   MVEVDDYSKPIYGGQNMIIGYQKKTVEDINEANWQSLIPVMGSDTPKVFYDHHLRHAKN
FT                   KDEVCHRLLAEKIATAFVGALTFHVADETGNEISSISFDTTLTSKYRKEGVLNVSVRFM
FT                   GPSQFSRDKVHYIKIRCGTANVLPDYSSIIVTSGFIRYKTPHYEGFLCRFQSIYDDLSP
FT                   SDGVTLYAGPSLDELRDPRKEDIALVNSLIDHLNDNLEWYHKAIWQLMPAERRFLLLDG
FT                   IVLPGSKGLGRSLASLVENELIGIVGNSLVFPVAKGLNLDPNFGASDSLTDYYMVAAGD
FT                   PVNVSIPTKGVYAEAMMGRCNSCEEKDESRFWRWEESPIPDTPTTINPISTESRRAEPG
FT                   NLQPTAFPNPMVNIQNAPNAPDPTGLAGTLSLLGKGDSFRDITGLTQNQTNALEALKAS
FT                   FDATKTFGQEAAKLEIQKMMDKRLDNAIKAINNNPNLDPKQKMELTEKALNAYLGAGAN
FT                   TTQPPKDANADKLQEGINKNLDKVNSSKSGEISVTKPDGTKVNTKFDGGTTSPAIETKI
FT                   GKGGITPMKQENSNACWATVATMMLRWKDSKNYTIEEVLTKAGSQYLNYYKQKTGLPYT
FT                   EKQNFITSLGMRGEPLANYTAQNYRDWLVEYGPLWVTTDTDQSKGFSAHALIITGISSD
FT                   LKSLEVIDPLQGRKFVQSFEEFANAFKELITDSGLLPTTQVVHFLEKIEATEGAPTPAD
FT                   IVKSLNEYNPSSSETLVINMVEFNTGISGITNYKDWKTDGSVIHNKRKNAYRDPFGIKH
FT                   LVLHETAAESGDGFDDSNNETSHMSVKRDATILQFNDLVEFENHGSGMNTTSIGIEFVN
FT                   RGWLSSSTADGGEGIPAKESSLTAAQKETYKEANGYLWAFWGYGFNIYRVPPSIDQLEK
FT                   EVELVKWLTRDFPALLQSISGISIYNLFPSIDDTWLQLVSYAEVKDIWTFKAADIPPEA
FT                   ERTEKNLFVMTTGYEYLEPSYLTDKSGIISHNAFYENHSDGSFLTLYTWLRLEKGKSKT
FT                   DALDIAKKLMKDHFIRVSLTSNTDKKIILLNVKDGNLV"
     MKIPVQLKNI GGNIPENDIA LQVSYFIKSQ NDELLPQSDA YIAPASGKID VSFGNNLARN        60
     KDVFFAVALK SNNILAQTST SATQLKDEVP ITMEFDYSPL VLSEPDDQIV SPRPLFVYGR       120
     LLDKQGKKKL EDVQIIFEAT RANDGGLQPI ASVRTEADGY FFIEYPQGSF IDASARVGLP       180
     LRENPIPVRL DEVRIDGDIS NKVFPRNVIL VAELMEAEEA TVEKECGCEV LDVHESKRIL       240
     EEYSFYSVVR TTEPEILGYV LKEEDEITLD EVLTQHPIRI WEIIDPIFQL PAFSHLANRA       300
     RVNLPEVTER SINTEITTRA HGRANTAPNP PQDNELAETL KQIKINRGVL NNFLQRETNI       360
     TKDNIVNLIE MNESYRFKQK MTLGETKPLG RVVLNSENSV DWDLEPTLYQ AVSVAHGHLL       420
     HFKSEWIADG YSLGDLLYSL PLAPGQKKQI VVFDWERRES ATNIQSLEYE ESLYNSLSRD       480
     RDIFEITKGV IEENIKGKSS ATTASASAGI GGVVGGLLFG VSGGVGHSGS TASQNSLRQT       540
     SASDLQKIRD RIVQSANAVR SQRSSVIQTV SQGERFEVSS ETVANYNHCH AITIQYYEVL       600
     RHFKVRQRFA EARECLFVPL LMSQFELNKL LRWRESLQFA LLNTNLSKGF DAAERIKNKW       660
     IGSNFPGGTF ASEKILNASG NFQIKFIIRR PDDKMVEVDD YSKPIYGGQN MIIGYQKKTV       720
     EDINEANWQS LIPVMGSDTP KVFYDHHLRH AKNKDEVCHR LLAEKIATAF VGALTFHVAD       780
     ETGNEISSIS FDTTLTSKYR KEGVLNVSVR FMGPSQFSRD KVHYIKIRCG TANVLPDYSS       840
     IIVTSGFIRY KTPHYEGFLC RFQSIYDDLS PSDGVTLYAG PSLDELRDPR KEDIALVNSL       900
     IDHLNDNLEW YHKAIWQLMP AERRFLLLDG IVLPGSKGLG RSLASLVENE LIGIVGNSLV       960
     FPVAKGLNLD PNFGASDSLT DYYMVAAGDP VNVSIPTKGV YAEAMMGRCN SCEEKDESRF      1020
     WRWEESPIPD TPTTINPIST ESRRAEPGNL QPTAFPNPMV NIQNAPNAPD PTGLAGTLSL      1080
     LGKGDSFRDI TGLTQNQTNA LEALKASFDA TKTFGQEAAK LEIQKMMDKR LDNAIKAINN      1140
     NPNLDPKQKM ELTEKALNAY LGAGANTTQP PKDANADKLQ EGINKNLDKV NSSKSGEISV      1200
     TKPDGTKVNT KFDGGTTSPA IETKIGKGGI TPMKQENSNA CWATVATMML RWKDSKNYTI      1260
     EEVLTKAGSQ YLNYYKQKTG LPYTEKQNFI TSLGMRGEPL ANYTAQNYRD WLVEYGPLWV      1320
     TTDTDQSKGF SAHALIITGI SSDLKSLEVI DPLQGRKFVQ SFEEFANAFK ELITDSGLLP      1380
     TTQVVHFLEK IEATEGAPTP ADIVKSLNEY NPSSSETLVI NMVEFNTGIS GITNYKDWKT      1440
     DGSVIHNKRK NAYRDPFGIK HLVLHETAAE SGDGFDDSNN ETSHMSVKRD ATILQFNDLV      1500
     EFENHGSGMN TTSIGIEFVN RGWLSSSTAD GGEGIPAKES SLTAAQKETY KEANGYLWAF      1560
     WGYGFNIYRV PPSIDQLEKE VELVKWLTRD FPALLQSISG ISIYNLFPSI DDTWLQLVSY      1620
     AEVKDIWTFK AADIPPEAER TEKNLFVMTT GYEYLEPSYL TDKSGIISHN AFYENHSDGS      1680
     FLTLYTWLRL EKGKSKTDAL DIAKKLMKDH FIRVSLTSNT DKKIILLNVK DGNLV           1735
//

If you have problems or comments...

PBIL Back to PBIL home page