(data stored in ACNUC7421 zone)

EMBL: CP000675.PE754

CP000675.PE754       Location/Qualifiers
FT   CDS             817654..818499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2634"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2634"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56549"
FT                   /protein_id="ABQ56549.1"
FT                   /translation="MSKKAIAISIVIALFFITAIWFAYSFVKQEENQNWLTLYGNIDIR
FT                   DVSLSFRVSGRILSMDVDEGAHVKKGQLLARLDKDTFIANLEMAKAQLKQAIANQKNAS
FT                   RTYKRREQLVDDGAVSKALFDDAVAMKDSSSAEVSVAKANLEKAQISLNDTEIHAPTHG
FT                   TILTRIQEPGAIVNVAEPVYTLAIDNPVWVRTYIDEPFLGRIYPGQDALVYTDSNPEKP
FT                   YKGHIGFISPQAEFTPKIVETTQLRTDLVYRIRVVIDQPDNGLRQGMPVTVKIHLKANS
FT                   "
     MSKKAIAISI VIALFFITAI WFAYSFVKQE ENQNWLTLYG NIDIRDVSLS FRVSGRILSM        60
     DVDEGAHVKK GQLLARLDKD TFIANLEMAK AQLKQAIANQ KNASRTYKRR EQLVDDGAVS       120
     KALFDDAVAM KDSSSAEVSV AKANLEKAQI SLNDTEIHAP THGTILTRIQ EPGAIVNVAE       180
     PVYTLAIDNP VWVRTYIDEP FLGRIYPGQD ALVYTDSNPE KPYKGHIGFI SPQAEFTPKI       240
     VETTQLRTDL VYRIRVVIDQ PDNGLRQGMP VTVKIHLKAN S                           281
//

If you have problems or comments...

PBIL Back to PBIL home page