(data stored in ACNUC7421 zone)

EMBL: CP000675.PE756

CP000675.PE756       Location/Qualifiers
FT   CDS             820262..821383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2632"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2632"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56547"
FT                   /protein_id="ABQ56547.1"
FT                   /translation="MNIRYLKALVIKETLQIIRDPSTILIAFVLPLILLFIFGYGVNLD
FT                   TDQVKFGLALESYDSSTVSLSQSFSSSRFLDVSISTNRQAFRYGLVNGTIRGFIDIPQR
FT                   FTADSLSGNPKPALQNIVDGSYPQVAGFAENYALGALQTWISSQAYEHGQMTLKSGINL
FT                   EPRYWYNQELKSRNFLIPGSIVIVMTLIGTLLTSLVIAREWERGTMEAMMATPISIVDI
FT                   ILGKLIPYFVLGMGSMFLCTIIATWYYGVPFQGTLLALTLVSAVFLVAALGQGLLISTL
FT                   ARDQFVASQLALMSAFLPSFILSGFIFEINSMPKWIQLLTHLFAARYFVTSLQTLFLTG
FT                   NIWSLLIRCLFAIALIGFAFFFITAHKTRKRLD"
     MNIRYLKALV IKETLQIIRD PSTILIAFVL PLILLFIFGY GVNLDTDQVK FGLALESYDS        60
     STVSLSQSFS SSRFLDVSIS TNRQAFRYGL VNGTIRGFID IPQRFTADSL SGNPKPALQN       120
     IVDGSYPQVA GFAENYALGA LQTWISSQAY EHGQMTLKSG INLEPRYWYN QELKSRNFLI       180
     PGSIVIVMTL IGTLLTSLVI AREWERGTME AMMATPISIV DIILGKLIPY FVLGMGSMFL       240
     CTIIATWYYG VPFQGTLLAL TLVSAVFLVA ALGQGLLIST LARDQFVASQ LALMSAFLPS       300
     FILSGFIFEI NSMPKWIQLL THLFAARYFV TSLQTLFLTG NIWSLLIRCL FAIALIGFAF       360
     FFITAHKTRK RLD                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page