(data stored in ACNUC7421 zone)

EMBL: CP000675.PE76

CP000675.PE76        Location/Qualifiers
FT   CDS             73291..74469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0076"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54076"
FT                   /protein_id="ABQ54076.1"
FT                   /translation="MLSVLSYRLSLLPKLSKTCYLLLLFSFLECVAGGIAYYLSLYLGT
FT                   STPLTKLQIGQVGSIVGFGALAGALCSTYITDKLNNKNIIIASFLFLGLGFFCLPQSMS
FT                   VLLISGCVFIIGFATSIFLTTNNTLLLQNAPQDQNSLRFIQSMKIVSENLGNSFSILLI
FT                   MFFAAQYYGQIFETIGLFFFLFALNTMKYLNVKQNSLEDSSYEEKETNQQGNNKRLYVT
FT                   ISAVFIVGIIYSQQRIAYPLFLHETFSSFTITAILFWLDPIIVSLFQIKITKIVSPLKI
FT                   SYQLAMGGLLLGTGLFALLIVDSIGGAIMACLTFILGEMLFMPTSFVRCYESAGNKRKG
FT                   MVAGAWRSAYSSGLIVGPFLSGFLMEYYSYNACWILAGILGFFLFILFSVKK"
     MLSVLSYRLS LLPKLSKTCY LLLLFSFLEC VAGGIAYYLS LYLGTSTPLT KLQIGQVGSI        60
     VGFGALAGAL CSTYITDKLN NKNIIIASFL FLGLGFFCLP QSMSVLLISG CVFIIGFATS       120
     IFLTTNNTLL LQNAPQDQNS LRFIQSMKIV SENLGNSFSI LLIMFFAAQY YGQIFETIGL       180
     FFFLFALNTM KYLNVKQNSL EDSSYEEKET NQQGNNKRLY VTISAVFIVG IIYSQQRIAY       240
     PLFLHETFSS FTITAILFWL DPIIVSLFQI KITKIVSPLK ISYQLAMGGL LLGTGLFALL       300
     IVDSIGGAIM ACLTFILGEM LFMPTSFVRC YESAGNKRKG MVAGAWRSAY SSGLIVGPFL       360
     SGFLMEYYSY NACWILAGIL GFFLFILFSV KK                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page